3OIX - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE PUTATIVE DIHYDROOROTATE DEHYDROGENASE FROM STREPTOCOCCUS MUTANS

Authors :   Y. Liu, Z. Q. Gao, C. P. Liu, Y. H. Dong

Date :   20 Aug 10 (Deposition) - 08 Sep 10 (Release) - 23 Feb 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.40

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B,C,D  (1x)
Biol. Unit 2: A,B  (1x)
Biol. Unit 3: C,D  (1x)

Keywords :   Tim Barrel, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Liu, Z. -Q. Gao, C. -P. Liu, J. -H. Xu, L. -F. Li, C. -N. Ji, X. -D. Su, Y. -H. Dong
Structure Of The Putative Dihydroorotate Dehydrogenase From Streptococcus Mutans
Acta Crystallogr. , Sect. F V. 67 182 2011
PubMed-ID: 21301083 | Reference-DOI: 10.1107/S1744309110048414

Molecule 1 - PUTATIVE DIHYDROOROTATE DEHYDROGENASE
	Chains	:	A, B, C, D
	EC Number	:	1.3.3.1, 1.3.5.2
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET28A
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	SMU.595
	Mutation	:	YES
	Organism Scientific	:	STREPTOCOCCUS MUTANS
	Organism Taxid	:	1309

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B	C	D
Biological Unit 2 (1x)	:	A	B
Biological Unit 3 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 36)

No.	Name	Count	Type	Full Name
1	FMN	4	Ligand/Ion	FLAVIN MONONUCLEOTIDE
2	GOL	4	Ligand/Ion	GLYCEROL
3	MLY	28	Mod. Amino Acid	N-DIMETHYL-LYSINE

Biological Unit 1 (3, 36)

No.	Name	Count	Type	Full Name
1	FMN	4	Ligand/Ion	FLAVIN MONONUCLEOTIDE
2	GOL	4	Ligand/Ion	GLYCEROL
3	MLY	28	Mod. Amino Acid	N-DIMETHYL-LYSINE

Biological Unit 2 (3, 18)

No.	Name	Count	Type	Full Name
1	FMN	2	Ligand/Ion	FLAVIN MONONUCLEOTIDE
2	GOL	2	Ligand/Ion	GLYCEROL
3	MLY	14	Mod. Amino Acid	N-DIMETHYL-LYSINE

Biological Unit 3 (3, 18)

No.	Name	Count	Type	Full Name
1	FMN	2	Ligand/Ion	FLAVIN MONONUCLEOTIDE
2	GOL	2	Ligand/Ion	GLYCEROL
3	MLY	14	Mod. Amino Acid	N-DIMETHYL-LYSINE

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ALA A:20 , ALA A:21 , GLY A:22 , THR A:46 , TYR A:60 , ASN A:69 , MET A:71 , ASN A:128 , LYS A:165 , ILE A:193 , ASN A:194 , GLY A:219 , GLY A:220 , THR A:247 , GLY A:248 , GLY A:249 , GLY A:270 , THR A:271 , HOH A:312 , HOH A:313 , HOH A:326 , HOH A:331 , HOH A:341 , HOH A:487	BINDING SITE FOR RESIDUE FMN A 400
2	AC2	SOFTWARE	TYR A:142 , PHE A:144 , HIS A:174 , HOH A:335 , HOH A:360 , HIS B:174 , HOH B:370 , GOL B:500	BINDING SITE FOR RESIDUE GOL A 500
3	AC3	SOFTWARE	ALA B:20 , ALA B:21 , GLY B:22 , THR B:46 , TYR B:60 , ASN B:69 , MET B:71 , ASN B:128 , LYS B:165 , ILE B:193 , ASN B:194 , GLY B:219 , GLY B:220 , THR B:247 , GLY B:248 , GLY B:249 , GLY B:270 , THR B:271 , HOH B:323 , HOH B:347 , HOH B:474	BINDING SITE FOR RESIDUE FMN B 400
4	AC4	SOFTWARE	HIS A:174 , GOL A:500 , TYR B:142 , PHE B:144 , HIS B:174 , HOH B:315 , HOH B:370	BINDING SITE FOR RESIDUE GOL B 500
5	AC5	SOFTWARE	ALA C:20 , ALA C:21 , GLY C:22 , THR C:46 , TYR C:60 , ASN C:69 , MET C:71 , ASN C:128 , LYS C:165 , ILE C:193 , ASN C:194 , GLY C:219 , GLY C:220 , THR C:247 , GLY C:248 , GLY C:249 , GLY C:270 , THR C:271 , HOH C:316 , HOH C:319 , HOH C:329 , HOH C:330 , HOH C:337	BINDING SITE FOR RESIDUE FMN C 400
6	AC6	SOFTWARE	TYR C:142 , PHE C:144 , HIS C:174 , HOH C:379 , HOH C:398 , HOH C:414 , HIS D:174 , GOL D:500	BINDING SITE FOR RESIDUE GOL C 500
7	AC7	SOFTWARE	ALA D:20 , ALA D:21 , GLY D:22 , THR D:46 , TYR D:60 , ASN D:69 , MET D:71 , ASN D:128 , LYS D:165 , ILE D:193 , ASN D:194 , GLY D:219 , GLY D:220 , THR D:247 , GLY D:248 , GLY D:249 , GLY D:270 , THR D:271 , HOH D:312 , HOH D:323 , HOH D:379	BINDING SITE FOR RESIDUE FMN D 400
8	AC8	SOFTWARE	HIS C:174 , GOL C:500 , TYR D:142 , PHE D:144 , HIS D:174 , HOH D:314	BINDING SITE FOR RESIDUE GOL D 500

(no "SS Bond" information available for 3OIX)

Asymmetric Unit

No.	Residues
1	Gln A:57	-	Pro A:58
2	Cys A:192	-	Ile A:193
3	Gln B:57	-	Pro B:58
4	Cys B:192	-	Ile B:193
5	Gln C:57	-	Pro C:58
6	Cys C:192	-	Ile C:193
7	Gln D:57	-	Pro D:58
8	Cys D:192	-	Ile D:193

(no "SAP(SNP)/Variant" information available for 3OIX)

(no "PROSITE Motif" information available for 3OIX)

(no "Exon" information available for 3OIX)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:310
 aligned with Q8DVA1_STRMU | Q8DVA1 from UniProtKB/TrEMBL  Length:311

    Alignment length:310
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311
         Q8DVA1_STRMU     2 VSTHTTIGSFDFDNCLMNAAGVYCMTREELAAIDHSEAGSFVTKTGTLEERAGNPQPRYADTKLGSINSMGLPNLGINYYLDYVTELQKQPDSKNHFLSLVGMSPEETHTILKMVEASKYQGLVELNLSCPNVPGKPQIAYDFETTDQILSEVFTYFTKPLGIKLPPYFDIVHFDQAAAIFNKYPLTFVNCINSIGNGLVIEDETVVIKPKNGFGGIGGDYVKPTALANVHAFYKRLNPSIQIIGTGGVKTGRDAFEHILCGASMVQIGTALHQEGPQIFKRITKELKAIMTEKGYETLEDFRGKLNAMA 311
               SCOP domains d3oixa_ A: automated matches                                                                                                                                                                                                                                                                                           SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee..eee...eee.......hhhhhhhhhh.......................eee...eeee.......hhhhhhhhhhhhhhh......eeee...hhhhhhhhhhhhhhh....eeeee..........hhhhhhhhhhhhhhhhh......eeeee....hhhhhhhhhhhhh.....eeee...eeeee.ee..ee..hhhh.eeeeee..hhhhhhhhhhhhhh......eeeee....hhhhhhhhhhhh..eeeehhhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3oix A   2 VSTHTTIGSFDFDNCLMNAAGVYCMTREELAAIDHSEAGSFVTkTGTLEERAGNPQPRYADTKLGSINSMGLPNLGINYYLDYVTELQKQPDSKNHFLSLVGMSPEETHTILkMVEASKYQGLVELNLSCPNVPGkPQIAYDFETTDQILSEVFTYFTKPLGIKLPPYFDIVHFDQAAAIFNkYPLTFVNCINSIGNGLVIEDETVVIkPKNGFGGIGGDYVKPTALANVHAFYKRLNPSIQIIGTGGVkTGRDAFEHILCGASMVQIGTALHQEGPQIFKRITKELkAIMTEKGYETLEDFRGKLNAMA 311
                                    11        21        31        41   |    51        61        71        81        91       101       111  |    121       131     | 141       151       161       171       181  |    191       201       211       221       231       241       251       261       271       281       291       301       311
                                                                      45-MLY                                                              114-MLY                137-MLY                                        184-MLY                   210-MLY                                  251-MLY                               289-MLY

Chain B from PDB  Type:PROTEIN  Length:310
 aligned with Q8DVA1_STRMU | Q8DVA1 from UniProtKB/TrEMBL  Length:311

    Alignment length:310
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311
         Q8DVA1_STRMU     2 VSTHTTIGSFDFDNCLMNAAGVYCMTREELAAIDHSEAGSFVTKTGTLEERAGNPQPRYADTKLGSINSMGLPNLGINYYLDYVTELQKQPDSKNHFLSLVGMSPEETHTILKMVEASKYQGLVELNLSCPNVPGKPQIAYDFETTDQILSEVFTYFTKPLGIKLPPYFDIVHFDQAAAIFNKYPLTFVNCINSIGNGLVIEDETVVIKPKNGFGGIGGDYVKPTALANVHAFYKRLNPSIQIIGTGGVKTGRDAFEHILCGASMVQIGTALHQEGPQIFKRITKELKAIMTEKGYETLEDFRGKLNAMA 311
               SCOP domains d3oixb_ B: automated matches                                                                                                                                                                                                                                                                                           SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee..eee...eee.......hhhhhhhhhh.......................eee...eeee.......hhhhhhhhhhhhhhh......eeee...hhhhhhhhhhhhhhh....eeeee..........hhhhhhhhhhhhhhhhh......eeeee....hhhhhhhhhhhhh.....eeee...eeeee.ee..ee..hhhh.eeeeee..hhhhhhhhhhhhhh......eeeee....hhhhhhhhhhhh..eeeehhhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3oix B   2 VSTHTTIGSFDFDNCLMNAAGVYCMTREELAAIDHSEAGSFVTkTGTLEERAGNPQPRYADTKLGSINSMGLPNLGINYYLDYVTELQKQPDSKNHFLSLVGMSPEETHTILkMVEASKYQGLVELNLSCPNVPGkPQIAYDFETTDQILSEVFTYFTKPLGIKLPPYFDIVHFDQAAAIFNkYPLTFVNCINSIGNGLVIEDETVVIkPKNGFGGIGGDYVKPTALANVHAFYKRLNPSIQIIGTGGVkTGRDAFEHILCGASMVQIGTALHQEGPQIFKRITKELkAIMTEKGYETLEDFRGKLNAMA 311
                                    11        21        31        41   |    51        61        71        81        91       101       111  |    121       131     | 141       151       161       171       181  |    191       201       211       221       231       241       251       261       271       281       291       301       311
                                                                      45-MLY                                                              114-MLY                137-MLY                                        184-MLY                   210-MLY                                  251-MLY                               289-MLY

Chain C from PDB  Type:PROTEIN  Length:310
 aligned with Q8DVA1_STRMU | Q8DVA1 from UniProtKB/TrEMBL  Length:311

    Alignment length:310
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311
         Q8DVA1_STRMU     2 VSTHTTIGSFDFDNCLMNAAGVYCMTREELAAIDHSEAGSFVTKTGTLEERAGNPQPRYADTKLGSINSMGLPNLGINYYLDYVTELQKQPDSKNHFLSLVGMSPEETHTILKMVEASKYQGLVELNLSCPNVPGKPQIAYDFETTDQILSEVFTYFTKPLGIKLPPYFDIVHFDQAAAIFNKYPLTFVNCINSIGNGLVIEDETVVIKPKNGFGGIGGDYVKPTALANVHAFYKRLNPSIQIIGTGGVKTGRDAFEHILCGASMVQIGTALHQEGPQIFKRITKELKAIMTEKGYETLEDFRGKLNAMA 311
               SCOP domains d3oixc_ C: automated matches                                                                                                                                                                                                                                                                                           SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee..eee...eee.......hhhhhhhhhh.......................eee...eeee.......hhhhhhhhhhhhhhh......eeee...hhhhhhhhhhhhhhh....eeeee..........hhhhhhhhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhh.....eeee...eeeee.ee..ee..hhhh.eeeeee..hhhhhhhhhhhhhh......eeeee....hhhhhhhhhhhh..eeeehhhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3oix C   2 VSTHTTIGSFDFDNCLMNAAGVYCMTREELAAIDHSEAGSFVTkTGTLEERAGNPQPRYADTKLGSINSMGLPNLGINYYLDYVTELQKQPDSKNHFLSLVGMSPEETHTILkMVEASKYQGLVELNLSCPNVPGkPQIAYDFETTDQILSEVFTYFTKPLGIKLPPYFDIVHFDQAAAIFNkYPLTFVNCINSIGNGLVIEDETVVIkPKNGFGGIGGDYVKPTALANVHAFYKRLNPSIQIIGTGGVkTGRDAFEHILCGASMVQIGTALHQEGPQIFKRITKELkAIMTEKGYETLEDFRGKLNAMA 311
                                    11        21        31        41   |    51        61        71        81        91       101       111  |    121       131     | 141       151       161       171       181  |    191       201       211       221       231       241       251       261       271       281       291       301       311
                                                                      45-MLY                                                              114-MLY                137-MLY                                        184-MLY                   210-MLY                                  251-MLY                               289-MLY

Chain D from PDB  Type:PROTEIN  Length:309
 aligned with Q8DVA1_STRMU | Q8DVA1 from UniProtKB/TrEMBL  Length:311

    Alignment length:309
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301         
         Q8DVA1_STRMU     2 VSTHTTIGSFDFDNCLMNAAGVYCMTREELAAIDHSEAGSFVTKTGTLEERAGNPQPRYADTKLGSINSMGLPNLGINYYLDYVTELQKQPDSKNHFLSLVGMSPEETHTILKMVEASKYQGLVELNLSCPNVPGKPQIAYDFETTDQILSEVFTYFTKPLGIKLPPYFDIVHFDQAAAIFNKYPLTFVNCINSIGNGLVIEDETVVIKPKNGFGGIGGDYVKPTALANVHAFYKRLNPSIQIIGTGGVKTGRDAFEHILCGASMVQIGTALHQEGPQIFKRITKELKAIMTEKGYETLEDFRGKLNAM 310
               SCOP domains d3oixd_ D: automated matches                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -DHO_dh-3oixD01 D:3-292                                                                                                                                                                                                                                                                            ------------------ Pfam domains (1)
           Pfam domains (2) -DHO_dh-3oixD02 D:3-292                                                                                                                                                                                                                                                                            ------------------ Pfam domains (2)
           Pfam domains (3) -DHO_dh-3oixD03 D:3-292                                                                                                                                                                                                                                                                            ------------------ Pfam domains (3)
           Pfam domains (4) -DHO_dh-3oixD04 D:3-292                                                                                                                                                                                                                                                                            ------------------ Pfam domains (4)
         Sec.struct. author ....eee..eee...eee.......hhhhhhhhhh.......................eee...eeee.......hhhhhhhhhhhhhhh......eeee...hhhhhhhhhhhhhhh....eeeee..........hhhhhhhhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhh.....eeee...eeeee.ee..ee..hhhh.eeeeee..hhhhhhhhhhhhhh......eeeee....hhhhhhhhhhhh..eeeehhhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3oix D   2 VSTHTTIGSFDFDNCLMNAAGVYCMTREELAAIDHSEAGSFVTkTGTLEERAGNPQPRYADTKLGSINSMGLPNLGINYYLDYVTELQKQPDSKNHFLSLVGMSPEETHTILkMVEASKYQGLVELNLSCPNVPGkPQIAYDFETTDQILSEVFTYFTKPLGIKLPPYFDIVHFDQAAAIFNkYPLTFVNCINSIGNGLVIEDETVVIkPKNGFGGIGGDYVKPTALANVHAFYKRLNPSIQIIGTGGVkTGRDAFEHILCGASMVQIGTALHQEGPQIFKRITKELkAIMTEKGYETLEDFRGKLNAM 310
                                    11        21        31        41   |    51        61        71        81        91       101       111  |    121       131     | 141       151       161       171       181  |    191       201       211       221       231       241       251       261       271       281       291       301         
                                                                      45-MLY                                                              114-MLY                137-MLY                                        184-MLY                   210-MLY                                  251-MLY                               289-MLY

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: TIM beta/alpha-barrel (3956)

Superfamily: FMN-linked oxidoreductases (290)

Family: automated matches (48)

Protein domain: automated matches (48)

Streptococcus mutans [TaxId: 1309] (2)

1a	d3oixa_	A:
1b	d3oixb_	B:
1c	d3oixc_	C:
1d	d3oixd_	D:

(no "CATH Domain" information available for 3OIX)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: TIM_barrel (694)

Family: DHO_dh (22)

Streptococcus mutans (1)

1a	DHO_dh-3oixD01	D:3-292
1b	DHO_dh-3oixD02	D:3-292
1c	DHO_dh-3oixD03	D:3-292
1d	DHO_dh-3oixD04	D:3-292

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (Q8DVA1_STRMU | Q8DVA1)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0004152	dihydroorotate dehydrogenase activity	Catalysis of the reaction: (S)-dihydroorotate + A = AH(2) + orotate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors	Catalysis of an oxidation-reduction (redox) reaction in which a CH-CH group acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
biological process
	GO:0044205	'de novo' UMP biosynthetic process	The chemical reactions and pathways resulting in the formation of UMP, uridine monophosphate, starting with the synthesis of (S)-dihydroorotate from bicarbonate; UMP biosynthesis may either occur via reduction by quinone, NAD(+) or oxygen.
	GO:0006207	'de novo' pyrimidine nucleobase biosynthetic process	The chemical reactions and pathways resulting in the formation of pyrimidine nucleobases, 1,3-diazine, organic nitrogenous bases, beginning with the synthesis of a pyrimidine ring from simpler precursors.
	GO:0006222	UMP biosynthetic process	The chemical reactions and pathways resulting in the formation of UMP, uridine monophosphate.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006221	pyrimidine nucleotide biosynthetic process	The chemical reactions and pathways resulting in the formation of a pyrimidine nucleotide, a compound consisting of nucleoside (a pyrimidine base linked to a deoxyribose or ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FMN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MLY	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Cys A:192 - Ile A:193	[ RasMol ]
		Cys B:192 - Ile B:193	[ RasMol ]
		Cys C:192 - Ile C:193	[ RasMol ]
		Cys D:192 - Ile D:193	[ RasMol ]
		Gln A:57 - Pro A:58	[ RasMol ]
		Gln B:57 - Pro B:58	[ RasMol ]
		Gln C:57 - Pro C:58	[ RasMol ]
		Gln D:57 - Pro D:58	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3oix
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q8DVA1_STRMU \| Q8DVA1
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	1.3.3.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	1.3.5.2
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q8DVA1_STRMU \| Q8DVA1
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 3OIX)

(no "Related Entries Specified in the PDB File" available for 3OIX)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 36)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (8, 8)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (0, 0)

Pfam Domains (1, 4)

Gene Ontology (11, 11)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File