3OFT - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF CYTOCHROME P450 CYP101C1

Authors :   W. Zhou, M. Ma, S. G. Bell, W. Yang, Y. Hao, N. H. Rees, M. Bartlam, L. -L. Wo

Date :   16 Aug 10 (Deposition) - 20 Jul 11 (Release) - 20 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym. Unit : A,B,C
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)

Keywords :   Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Ma, S. G. Bell, W. Yang, Y. Hao, N. H. Rees, M. Bartlam, W. Zhou, L. L. Wong, Z. Rao
Structural Analysis Of Cyp101C1 From Novosphingobium Aromaticivorans Dsm12444.
Chembiochem V. 12 88 2011
PubMed-ID: 21154803 | Reference-DOI: 10.1002/CBIC.201000537

Molecule 1 - CYTOCHROME P450
	Chains	:	A, B, C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET28A
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	SARO_2249
	Organism Scientific	:	NOVOSPHINGOBIUM AROMATICIVORANS
	Organism Taxid	:	279238
	Strain	:	DSM 12444
	Synonym	:	CYP101C1

		1	2	3
Asymmetric Unit	:	A	B	C
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 6)

No.	Name	Count	Type	Full Name
1	HEM	3	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE
2	HX2	3	Ligand/Ion	(2R,5R)-HEXANE-2,5-DIOL

Biological Unit 1 (2, 2)

No.	Name	Count	Type	Full Name
1	HEM	1	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE
2	HX2	1	Ligand/Ion	(2R,5R)-HEXANE-2,5-DIOL

Biological Unit 2 (2, 2)

No.	Name	Count	Type	Full Name
1	HEM	1	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE
2	HX2	1	Ligand/Ion	(2R,5R)-HEXANE-2,5-DIOL

Biological Unit 3 (2, 2)

No.	Name	Count	Type	Full Name
1	HEM	1	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE
2	HX2	1	Ligand/Ion	(2R,5R)-HEXANE-2,5-DIOL

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	TRP A:61 , PRO A:86 , LEU A:87 , HIS A:94 , ARG A:98 , ASN A:230 , LEU A:231 , GLY A:234 , GLY A:235 , THR A:238 , MET A:242 , VAL A:283 , ARG A:285 , THR A:337 , MET A:338 , GLY A:339 , HIS A:343 , CYS A:345 , VAL A:346 , ALA A:351 , GLU A:354 , HX2 A:397 , HOH A:398 , HOH A:461 , HOH A:469 , HOH A:526	BINDING SITE FOR RESIDUE HEM A 417
2	AC2	SOFTWARE	ALA A:282 , ASN A:383 , HOH A:398 , HEM A:417 , HOH A:521 , HOH A:618	BINDING SITE FOR RESIDUE HX2 A 397
3	AC3	SOFTWARE	TRP B:61 , PRO B:86 , LEU B:87 , HIS B:94 , ARG B:98 , ASN B:230 , LEU B:231 , GLY B:234 , GLY B:235 , THR B:238 , MET B:242 , VAL B:283 , ARG B:285 , THR B:337 , MET B:338 , GLY B:339 , HIS B:343 , CYS B:345 , VAL B:346 , ALA B:351 , HOH B:399 , HOH B:459 , HOH B:518 , HOH B:604	BINDING SITE FOR RESIDUE HEM B 417
4	AC4	SOFTWARE	ALA B:282 , VAL B:283 , ASN B:383 , HOH B:399 , HOH B:487 , HOH B:518 , HOH B:519 , HOH B:600 , HOH B:612	BINDING SITE FOR RESIDUE HX2 B 397
5	AC5	SOFTWARE	TRP C:61 , PRO C:86 , LEU C:87 , HIS C:94 , ARG C:98 , ASN C:230 , LEU C:231 , GLY C:234 , GLY C:235 , THR C:238 , MET C:242 , VAL C:283 , ARG C:285 , THR C:337 , MET C:338 , GLY C:339 , HIS C:343 , CYS C:345 , VAL C:346 , HX2 C:397 , HOH C:398 , HOH C:410 , HOH C:499 , HOH C:542	BINDING SITE FOR RESIDUE HEM C 417
6	AC6	SOFTWARE	LEU C:72 , ALA C:282 , VAL C:283 , ASN C:383 , HOH C:398 , HEM C:417 , HOH C:437 , HOH C:441 , HOH C:475	BINDING SITE FOR RESIDUE HX2 C 397

(no "SS Bond" information available for 3OFT)

Asymmetric Unit

No.	Residues
1	Ile A:85	-	Pro A:86
2	Gly A:175	-	Ser A:176
3	Ile B:85	-	Pro B:86
4	Ile C:85	-	Pro C:86

(no "SAP(SNP)/Variant" information available for 3OFT)

(no "PROSITE Motif" information available for 3OFT)

(no "Exon" information available for 3OFT)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:396
 aligned with Q2G637_NOVAD | Q2G637 from UniProtKB/TrEMBL  Length:396

    Alignment length:396
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390      
         Q2G637_NOVAD     1 MIPAHVPADRVVDFDIFNPPGVEQDYFAAWKTLLDGPGLVWSTANGGHWIAARGDVVRELWGDAERLSSQCLAVTPGLGKVMQFIPLQQDGAEHKAFRTPVMKGLASRFVVALEPKVQAVARKLMESLRPRGSCDFVSDFAEILPLNIFLTLIDVPLEDRPRLRQLGVQLTRPDGSMTVEQLKQAADDYLWPFIEKRMAQPGDDLFSRILSEPVGGRPWTVDEARRMCRNLLFGGLDTVAAMIGMVALHLARHPEDQRLLRERPDLIPAAADELMRRYPTVAVSRNAVADVDADGVTIRKGDLVYLPSVLHNLDPASFEAPEEVRFDRGLAPIRHTTMGVGAHRCVGAGLARMEVIVFLREWLGGMPEFALAPDKAVTMKGGNVGACTALPLVWRA 396
               SCOP domains d3ofta_ A: automated matches                                                                                                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......hhh.ee............hhhhhhhhhhhh..eeee.....eeee.hhhhhhhhhhh...ee........hhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeehhhhh..hhhhhhhhhhh..hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh...eeeeee...eee..eee....eeeeehhhhhh.................hhhhh....hhhhh..hhhhhhhhhhhhhhhhhhhh..eee......eee.....eeee.eeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3oft A   1 MIPAHVPADRVVDFDIFNPPGVEQDYFAAWKTLLDGPGLVWSTANGGHWIAARGDVVRELWGDAERLSSQCLAVTPGLGKVMQFIPLQQDGAEHKAFRTPVMKGLASRFVVALEPKVQAVARKLMESLRPRGSCDFVSDFAEILPLNIFLTLIDVPLEDRPRLRQLGVQLTRPDGSMTVEQLKQAADDYLWPFIEKRMAQPGDDLFSRILSEPVGGRPWTVDEARRMCRNLLFGGLDTVAAMIGMVALHLARHPEDQRLLRERPDLIPAAADELMRRYPTVAVSRNAVADVDADGVTIRKGDLVYLPSVLHNLDPASFEAPEEVRFDRGLAPIRHTTMGVGAHRCVGAGLARMEVIVFLREWLGGMPEFALAPDKAVTMKGGNVGACTALPLVWRA 396
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390

Chain B from PDB  Type:PROTEIN  Length:393
 aligned with Q2G637_NOVAD | Q2G637 from UniProtKB/TrEMBL  Length:396

    Alignment length:396
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390      
         Q2G637_NOVAD     1 MIPAHVPADRVVDFDIFNPPGVEQDYFAAWKTLLDGPGLVWSTANGGHWIAARGDVVRELWGDAERLSSQCLAVTPGLGKVMQFIPLQQDGAEHKAFRTPVMKGLASRFVVALEPKVQAVARKLMESLRPRGSCDFVSDFAEILPLNIFLTLIDVPLEDRPRLRQLGVQLTRPDGSMTVEQLKQAADDYLWPFIEKRMAQPGDDLFSRILSEPVGGRPWTVDEARRMCRNLLFGGLDTVAAMIGMVALHLARHPEDQRLLRERPDLIPAAADELMRRYPTVAVSRNAVADVDADGVTIRKGDLVYLPSVLHNLDPASFEAPEEVRFDRGLAPIRHTTMGVGAHRCVGAGLARMEVIVFLREWLGGMPEFALAPDKAVTMKGGNVGACTALPLVWRA 396
               SCOP domains d3oftb_ B: automated matches                                                                                                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......hhh.ee............hhhhhhhhhhhh..eeee.....eeee.hhhhhhhhhhh...ee........hhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeehhhhh..hhhhhhhhhhh..hhhhhhhhhhhhhhhhh---..hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh...eeeeee...eee..eee....eeeeehhhhhh.................hhhhh....hhhhh..hhhhhhhhhhhhhhhhhhhh..eee......eee.....eeee.eeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3oft B   1 MIPAHVPADRVVDFDIFNPPGVEQDYFAAWKTLLDGPGLVWSTANGGHWIAARGDVVRELWGDAERLSSQCLAVTPGLGKVMQFIPLQQDGAEHKAFRTPVMKGLASRFVVALEPKVQAVARKLMESLRPRGSCDFVSDFAEILPLNIFLTLIDVPLEDRPRLRQLGVQLTR---SMTVEQLKQAADDYLWPFIEKRMAQPGDDLFSRILSEPVGGRPWTVDEARRMCRNLLFGGLDTVAAMIGMVALHLARHPEDQRLLRERPDLIPAAADELMRRYPTVAVSRNAVADVDADGVTIRKGDLVYLPSVLHNLDPASFEAPEEVRFDRGLAPIRHTTMGVGAHRCVGAGLARMEVIVFLREWLGGMPEFALAPDKAVTMKGGNVGACTALPLVWRA 396
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170 |   | 180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390      
                                                                                                                                                                                                     172 176

Chain C from PDB  Type:PROTEIN  Length:390
 aligned with Q2G637_NOVAD | Q2G637 from UniProtKB/TrEMBL  Length:396

    Alignment length:396
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390      
         Q2G637_NOVAD     1 MIPAHVPADRVVDFDIFNPPGVEQDYFAAWKTLLDGPGLVWSTANGGHWIAARGDVVRELWGDAERLSSQCLAVTPGLGKVMQFIPLQQDGAEHKAFRTPVMKGLASRFVVALEPKVQAVARKLMESLRPRGSCDFVSDFAEILPLNIFLTLIDVPLEDRPRLRQLGVQLTRPDGSMTVEQLKQAADDYLWPFIEKRMAQPGDDLFSRILSEPVGGRPWTVDEARRMCRNLLFGGLDTVAAMIGMVALHLARHPEDQRLLRERPDLIPAAADELMRRYPTVAVSRNAVADVDADGVTIRKGDLVYLPSVLHNLDPASFEAPEEVRFDRGLAPIRHTTMGVGAHRCVGAGLARMEVIVFLREWLGGMPEFALAPDKAVTMKGGNVGACTALPLVWRA 396
               SCOP domains d3oftc_ C: automated matches                                                                                                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......hhh.ee............hhhhhhhhhhhh..eeee.hhhheeee.hhhhhhhhhhh...ee........hhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeehhhhh..hhhhhhhhhhh..hhhhhhhhhhhh...------.hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh...eeeeee...eee..eee....eeeeehhhhhh.................hhhhh....hhhhh..hhhhhhhhhhhhhhhhhhhh..eee......eee.....eeee.eeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3oft C   1 MIPAHVPADRVVDFDIFNPPGVEQDYFAAWKTLLDGPGLVWSTANGGHWIAARGDVVRELWGDAERLSSQCLAVTPGLGKVMQFIPLQQDGAEHKAFRTPVMKGLASRFVVALEPKVQAVARKLMESLRPRGSCDFVSDFAEILPLNIFLTLIDVPLEDRPRLRQLGVQL------MTVEQLKQAADDYLWPFIEKRMAQPGDDLFSRILSEPVGGRPWTVDEARRMCRNLLFGGLDTVAAMIGMVALHLARHPEDQRLLRERPDLIPAAADELMRRYPTVAVSRNAVADVDADGVTIRKGDLVYLPSVLHNLDPASFEAPEEVRFDRGLAPIRHTTMGVGAHRCVGAGLARMEVIVFLREWLGGMPEFALAPDKAVTMKGGNVGACTALPLVWRA 396
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170      |180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390      
                                                                                                                                                                                                   170    177

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Cytochrome P450 (480)

Superfamily: Cytochrome P450 (480)

Family: automated matches (157)

Protein domain: automated matches (157)

Novosphingobium aromaticivorans [TaxId: 279238] (11)

1a	d3ofta_	A:
1b	d3oftb_	B:
1c	d3oftc_	C:

(no "CATH Domain" information available for 3OFT)

(no "Pfam Domain" information available for 3OFT)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C (Q2G637_NOVAD | Q2G637)

molecular function
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004497	monooxygenase activity	Catalysis of the incorporation of one atom from molecular oxygen into a compound and the reduction of the other atom of oxygen to water.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from each of two donors, and molecular oxygen is reduced or incorporated into a donor.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		HX2	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gly A:175 - Ser A:176	[ RasMol ]
		Ile A:85 - Pro A:86	[ RasMol ]
		Ile B:85 - Pro B:86	[ RasMol ]
		Ile C:85 - Pro C:86	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3oft
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q2G637_NOVAD \| Q2G637
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q2G637_NOVAD \| Q2G637
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/TrEMBL
	Q2G637_NOVAD \| Q2G637	:	3ofu

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 3)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (7, 7)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File