|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric Unit (2, 4) Biological Unit 1 (1, 1) Biological Unit 2 (2, 3) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (6, 6)
Asymmetric Unit
|
||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3ODV) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3ODV) |
PROSITE Motifs (1, 2)
Asymmetric Unit (1, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3ODV) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:38 aligned with KAX31_ANDMA | P24662 from UniProtKB/Swiss-Prot Length:38 Alignment length:38 10 20 30 KAX31_ANDMA 1 GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK 38 SCOP domains -------------------------------------- SCOP domains CATH domains -------------------------------------- CATH domains Pfam domains -------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------- SAPs(SNPs) PROSITE -------------SCORP_SHORT_TOXIN --- PROSITE Transcript -------------------------------------- Transcript 3odv A 1 GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK 38 10 20 30 Chain B from PDB Type:PROTEIN Length:38 aligned with KAX31_ANDMA | P24662 from UniProtKB/Swiss-Prot Length:38 Alignment length:38 10 20 30 KAX31_ANDMA 1 GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK 38 SCOP domains -------------------------------------- SCOP domains CATH domains -------------------------------------- CATH domains Pfam domains (1) -----Toxin_2-3odvB01 B:6-36 -- Pfam domains (1) Pfam domains (2) -----Toxin_2-3odvB02 B:6-36 -- Pfam domains (2) SAPs(SNPs) -------------------------------------- SAPs(SNPs) PROSITE -------------SCORP_SHORT_TOXIN --- PROSITE Transcript -------------------------------------- Transcript 3odv B 1 GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK 38 10 20 30
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3ODV) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3ODV) |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A,B (KAX31_ANDMA | P24662)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|