![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 4) Biological Unit 1 (1, 1) Biological Unit 2 (2, 3) |
Asymmetric Unit (4, 4)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 3ODV) |
(no "SAP(SNP)/Variant" information available for 3ODV) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 3ODV) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:38 aligned with KAX31_ANDMA | P24662 from UniProtKB/Swiss-Prot Length:38 Alignment length:38 10 20 30 KAX31_ANDMA 1 GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK 38 SCOP domains -------------------------------------- SCOP domains CATH domains -------------------------------------- CATH domains Pfam domains -------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------- SAPs(SNPs) PROSITE -------------SCORP_SHORT_TOXIN --- PROSITE Transcript -------------------------------------- Transcript 3odv A 1 GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK 38 10 20 30 Chain B from PDB Type:PROTEIN Length:38 aligned with KAX31_ANDMA | P24662 from UniProtKB/Swiss-Prot Length:38 Alignment length:38 10 20 30 KAX31_ANDMA 1 GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK 38 SCOP domains -------------------------------------- SCOP domains CATH domains -------------------------------------- CATH domains Pfam domains (1) -----Toxin_2-3odvB01 B:6-36 -- Pfam domains (1) Pfam domains (2) -----Toxin_2-3odvB02 B:6-36 -- Pfam domains (2) SAPs(SNPs) -------------------------------------- SAPs(SNPs) PROSITE -------------SCORP_SHORT_TOXIN --- PROSITE Transcript -------------------------------------- Transcript 3odv B 1 GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK 38 10 20 30
|
(no "SCOP Domain" information available for 3ODV) |
(no "CATH Domain" information available for 3ODV) |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B (KAX31_ANDMA | P24662)
|
|
|
|
|
|
|