3ODN - JenaLib

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:366
 aligned with Q9GPL5_DROME | Q9GPL5 from UniProtKB/TrEMBL  Length:765

    Alignment length:498
                                   126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606        
         Q9GPL5_DROME   117 TCCTYNMETRMAMQSRQQLEGHTKDQISRMSGILGSKATKFKDIFTALLKESRTQFNSMFIRTYGVIYERNSYVFSDLFKELETYFANGRVDLLEVMDKFFNTLYQKMFTVLNTQYTFDENYMRCVSEHMKELKPFGDVPDKLSVQIKRSFVATRTYGQALTTASEVAKKVLNVRLNADCTGALTKMQHCGACKGYTEKPCTNYCVNVIKGCLHYQHEFDSEWENFAMAMDKVAERLLGSFNIVMVVEPLNIKISEAIMNFQDSGQDITNRVFQGCGRPKLKKMKRSISPKLQGVQILNARSPVEADTLDIDETLDEAIVLRERRAAEPGSQETSSQQSQEQGVGKSGNGGGGGGGNNRRQQQRRKQQQQRRKQQNNRDDNDDDDNESGGGREPILDRIVRDIRQRVKDYKKFWSNLPHSVCSNEDIASSSDVDGMCWNGHTIDRYMHSITTEHGSNPEFTGNPASTKQTAQMASQLSHLKNAIVHLRNAYNGQDVEW 614
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh----.hhhhhhhhhhhh.hhhhh.....hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..------------------------------------------------------------------------------------------------------------------.hhhhhhhhhhhhhhhhh.....hhhhhhhhh......hhhhh..................--.....------------hhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3odn A 117 TCCTYNMETRMAMQSRQQLEGHTKDQISRMSGILGSKATKFKDIFTALLKESRTQFNSMFIRTYGVIYERNSYVFSDLFKELETYFANGRVDLLEVMDKFFNTLYQKMFTVLNTQYTFDENYMRCVSEHMKELKPFGDVPDKLSVQIKRSFVATRTYGQALTTASEVAKKVL----NADCTGALTKMQHCGACKGYTEKPCTNYCVNVIKGCLHYQHEFDSEWENFAMAMDKVAERLLGSFNIVMVVEPLNIKISEAIMNFQDSGQDITNRVFQGCGR------------------------------------------------------------------------------------------------------------------EPILDRIVRDIRQRVKDYKKFWSNLPHSVCSNEDIASSSDVDGMCWNGHTIDRYMHSITTE--SNPEF------------MASQLSHLKNAIVHLRNAYNGQDVEW 614
                                   126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286 |    |296       306       316       326       336       346       356       366       376       386       | -         -         -         -         -         -         -         -         -         -         -         -  |    516       526       536       546       556       566  |  | 576         -  |    596       606        
                                                                                                                                                                                                     288  293                                                                                                  394                                                                                                                509                                                         569  | 576          589                         
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 572

Chain A from PDB  Type:PROTEIN  Length:366
 aligned with Q9VUG1_DROME | Q9VUG1 from UniProtKB/TrEMBL  Length:765

    Alignment length:498
                                   126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606        
         Q9VUG1_DROME   117 TCCTYNMETRMAMQSRQQLEGHTKDQISRMSGILGSKATKFKDIFTALLKESRTQFNSMFIRTYGVIYERNSYVFSDLFKELETYFANGRVDLLEVMDKFFNTLYQKMFTVLNTQYTFDENYMRCVSEHMKELKPFGDVPDKLSVQIKRSFVATRTYGQALTTASEVAKKVLNVRLNADCTGALTKMQHCGACKGYTEKPCTNYCVNVIKGCLHYQHEFDSEWENFAMAMDKVAERLLGSFNIVMVVEPLNIKISEAIMNFQDSGQDITNRVFQGCGRPKLKKMKRSISPKLQGVQILNARSPVEADTLDIDETLDEAIVLRERRAAEPGSQETSAQQSQEQGVGKSGNGGGGGGGNNRRQQQRRKQQQQRRKQQNNRDDNDDDDNESGGGREPILDRIVRDIRQRVKDYKKFWSNLPHSVCSNEDIASSSDVDGMCWNGHTIDRYMHSITTEHGSNPEFTGNPASTKQTAQMASQLSHLKNAIVHLRNAYNGQDVEW 614
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh----.hhhhhhhhhhhh.hhhhh.....hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..------------------------------------------------------------------------------------------------------------------.hhhhhhhhhhhhhhhhh.....hhhhhhhhh......hhhhh..................--.....------------hhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3odn A 117 TCCTYNMETRMAMQSRQQLEGHTKDQISRMSGILGSKATKFKDIFTALLKESRTQFNSMFIRTYGVIYERNSYVFSDLFKELETYFANGRVDLLEVMDKFFNTLYQKMFTVLNTQYTFDENYMRCVSEHMKELKPFGDVPDKLSVQIKRSFVATRTYGQALTTASEVAKKVL----NADCTGALTKMQHCGACKGYTEKPCTNYCVNVIKGCLHYQHEFDSEWENFAMAMDKVAERLLGSFNIVMVVEPLNIKISEAIMNFQDSGQDITNRVFQGCGR------------------------------------------------------------------------------------------------------------------EPILDRIVRDIRQRVKDYKKFWSNLPHSVCSNEDIASSSDVDGMCWNGHTIDRYMHSITTE--SNPEF------------MASQLSHLKNAIVHLRNAYNGQDVEW 614
                                   126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286 |    |296       306       316       326       336       346       356       366       376       386       | -         -         -         -         -         -         -         -         -         -         -         -  |    516       526       536       546       556       566  |  | 576         -  |    596       606        
                                                                                                                                                                                                     288  293                                                                                                  394                                                                                                                509                                                         569  | 576          589                         
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 572

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (Q9GPL5_DROME | Q9GPL5)

molecular function
	GO:0017147	Wnt-protein binding	Interacting selectively and non-covalently with Wnt-protein, a secreted growth factor involved in signaling.
	GO:0043395	heparan sulfate proteoglycan binding	Interacting selectively and non-covalently with a heparan sulfate proteoglycan, any proteoglycan containing heparan sulfate as the glycosaminoglycan carbohydrate unit.
biological process
	GO:0016055	Wnt signaling pathway	The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
	GO:0007411	axon guidance	The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
	GO:0048749	compound eye development	The process whose specific outcome is the progression of the compound eye over time, from its formation to the mature structure. The compound eye is an organ of sight that contains multiple repeating units, often arranged hexagonally. Each unit has its own lens and photoreceptor cell(s) and can generate either a single pixelated image or multiple images, per eye.
	GO:0008101	decapentaplegic signaling pathway	A series of molecular signals initiated by the binding of decapentaplegic (dpp) to a receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0050908	detection of light stimulus involved in visual perception	The series of events involved in visual perception in which a light stimulus is received and converted into a molecular signal.
	GO:0008587	imaginal disc-derived wing margin morphogenesis	The process in which the anatomical structures of the imaginal disc-derived wing margin are generated and organized. The wing margin is a strip of cells in the third instar disc at the boundary between the presumptive dorsal and ventral surfaces of the wing blade.
	GO:0030178	negative regulation of Wnt signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of the Wnt signaling pathway.
	GO:0007528	neuromuscular junction development	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a neuromuscular junction.
	GO:0030177	positive regulation of Wnt signaling pathway	Any process that activates or increases the frequency, rate or extent of Wnt signal transduction.
	GO:0045880	positive regulation of smoothened signaling pathway	Any process that activates or increases the frequency, rate or extent of smoothened signaling.
	GO:0045570	regulation of imaginal disc growth	Any process that modulates the frequency, rate or extent of the growth of the imaginal disc.
	GO:0008589	regulation of smoothened signaling pathway	Any process that modulates the frequency, rate or extent of smoothened signaling.
	GO:0007367	segment polarity determination	Division of the 14 parasegments of the embryo into anterior and posterior compartments; exemplified by the actions of the segment polarity gene products.
	GO:0007224	smoothened signaling pathway	A series of molecular signals generated as a consequence of activation of the transmembrane protein Smoothened.
	GO:0048190	wing disc dorsal/ventral pattern formation	The establishment, maintenance and elaboration of the dorsal/ventral axis of the wing disc, a precursor to the adult wing.
cellular component
	GO:0031225	anchored component of membrane	The component of a membrane consisting of the gene products that are tethered to the membrane only by a covalently attached anchor, such as a lipid group that is embedded in the membrane. Gene products with peptide sequences that are embedded in the membrane are excluded from this grouping.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0031594	neuromuscular junction	The junction between the axon of a motor neuron and a muscle fiber. In response to the arrival of action potentials, the presynaptic button releases molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane of the muscle fiber, leading to a change in post-synaptic potential.
	GO:0098595	perivitelline space	The space between the membrane of an oocyte and a surrounding membranous structure (zona pellucida or perivitelline membrane).
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0005578	proteinaceous extracellular matrix	A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.
	GO:0045202	synapse	The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.

Chain A (Q9VUG1_DROME | Q9VUG1)

molecular function
	GO:0017147	Wnt-protein binding	Interacting selectively and non-covalently with Wnt-protein, a secreted growth factor involved in signaling.
	GO:0043395	heparan sulfate proteoglycan binding	Interacting selectively and non-covalently with a heparan sulfate proteoglycan, any proteoglycan containing heparan sulfate as the glycosaminoglycan carbohydrate unit.
biological process
	GO:0016055	Wnt signaling pathway	The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
	GO:0007411	axon guidance	The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
	GO:0048749	compound eye development	The process whose specific outcome is the progression of the compound eye over time, from its formation to the mature structure. The compound eye is an organ of sight that contains multiple repeating units, often arranged hexagonally. Each unit has its own lens and photoreceptor cell(s) and can generate either a single pixelated image or multiple images, per eye.
	GO:0008101	decapentaplegic signaling pathway	A series of molecular signals initiated by the binding of decapentaplegic (dpp) to a receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0050908	detection of light stimulus involved in visual perception	The series of events involved in visual perception in which a light stimulus is received and converted into a molecular signal.
	GO:0008587	imaginal disc-derived wing margin morphogenesis	The process in which the anatomical structures of the imaginal disc-derived wing margin are generated and organized. The wing margin is a strip of cells in the third instar disc at the boundary between the presumptive dorsal and ventral surfaces of the wing blade.
	GO:0030178	negative regulation of Wnt signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of the Wnt signaling pathway.
	GO:0007528	neuromuscular junction development	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a neuromuscular junction.
	GO:0030177	positive regulation of Wnt signaling pathway	Any process that activates or increases the frequency, rate or extent of Wnt signal transduction.
	GO:0045880	positive regulation of smoothened signaling pathway	Any process that activates or increases the frequency, rate or extent of smoothened signaling.
	GO:0045570	regulation of imaginal disc growth	Any process that modulates the frequency, rate or extent of the growth of the imaginal disc.
	GO:0008589	regulation of smoothened signaling pathway	Any process that modulates the frequency, rate or extent of smoothened signaling.
	GO:0007367	segment polarity determination	Division of the 14 parasegments of the embryo into anterior and posterior compartments; exemplified by the actions of the segment polarity gene products.
	GO:0007224	smoothened signaling pathway	A series of molecular signals generated as a consequence of activation of the transmembrane protein Smoothened.
	GO:0048190	wing disc dorsal/ventral pattern formation	The establishment, maintenance and elaboration of the dorsal/ventral axis of the wing disc, a precursor to the adult wing.
cellular component
	GO:0031225	anchored component of membrane	The component of a membrane consisting of the gene products that are tethered to the membrane only by a covalently attached anchor, such as a lipid group that is embedded in the membrane. Gene products with peptide sequences that are embedded in the membrane are excluded from this grouping.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0031594	neuromuscular junction	The junction between the axon of a motor neuron and a muscle fiber. In response to the arrival of action potentials, the presynaptic button releases molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane of the muscle fiber, leading to a change in post-synaptic potential.
	GO:0098595	perivitelline space	The space between the membrane of an oocyte and a surrounding membranous structure (zona pellucida or perivitelline membrane).
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0005578	proteinaceous extracellular matrix	A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.
	GO:0045202	synapse	The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (4, 4)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (27, 53)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File