Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF A HEMOLYSIN-LIKE PROTEIN CONTAINING CBS DOMAIN OF OENOCOCCUS OENI PSU
 
Authors :  K. Tan, C. Hatzos, G. Cobb, A. Joachimiak, Midwest Center For Struct Genomics (Mcsg)
Date :  10 Aug 10  (Deposition) - 06 Oct 10  (Release) - 06 Oct 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. Tan, C. Hatzos, G. Cobb, A. Joachimiak
The Crystal Structure Of A Hemolysin-Like Protein Containin Cbs Domain Of Oenococcus Oeni Psu
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HEMOLYSIN-LIKE PROTEIN CONTAINING CBS DOMAINS
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PMCSG19
    Expression System Strain: PPK1037
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: OEOE_0137
    Organism Scientific: OENOCOCCUS OENI
    Organism Taxid: 203123
    Strain: PSU-1

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 18)

Asymmetric/Biological Unit (1, 18)
No.NameCountTypeFull Name
1MSE18Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3OCO)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3OCO)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3OCO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3OCO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3OCO)

(-) Exons   (0, 0)

(no "Exon" information available for 3OCO)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:136
 aligned with Q04HE1_OENOB | Q04HE1 from UniProtKB/TrEMBL  Length:470

    Alignment length:136
                                   220       230       240       250       260       270       280       290       300       310       320       330       340      
         Q04HE1_OENOB   211 ANFMQRAFEMNDKVASDVMVDRTSMSVVDVDETIADALLLYLEEQYSRFPVTADNDKDKIIGYAYNYDIVRQARIDDKAKISTIMRDIVSVPENMKVPDVMEEMSAHRVPMAIVIDEYGGTSGIITDKDVYEELFG 346
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhee.hhh..ee...hhhhhhhhhhhhh..eeeeee..eeeeeeeeeehhhhhhhhhhhh..hhhhh....eeee...hhhhhhhhhhhh....eeee.....eeeeehhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3oco A 211 ANFmQRAFEmNDKVASDVmVDRTSmSVVDVDETIADALLLYLEEQYSRFPVTADNDKDKIIGYAYNYDIVRQARIDDKAKISTImRDIVSVPENmKVPDVmEEmSAHRVPmAIVIDEYGGTSGIITDKDVYEELFG 346
                               |   220       230    |  240       250       260       270       280       290    |  300    |  310|  |   320|      330       340      
                               |     |      229-MSE |                                                         295-MSE   305-MSE |  |      |                         
                             214-MSE |            235-MSE                                                                     311-MSE     |                         
                                   220-MSE                                                                                       314-MSE  |                         
                                                                                                                                        321-MSE                     


Chain B from PDB  Type:PROTEIN  Length:136
 aligned with Q04HE1_OENOB | Q04HE1 from UniProtKB/TrEMBL  Length:470

    Alignment length:136
                                   220       230       240       250       260       270       280       290       300       310       320       330       340      
         Q04HE1_OENOB   211 ANFMQRAFEMNDKVASDVMVDRTSMSVVDVDETIADALLLYLEEQYSRFPVTADNDKDKIIGYAYNYDIVRQARIDDKAKISTIMRDIVSVPENMKVPDVMEEMSAHRVPMAIVIDEYGGTSGIITDKDVYEELFG 346
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------CBS-3ocoB01 B:291-346                                    Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------------CBS-3ocoB02 B:291-346                                    Pfam domains (2)
           Pfam domains (3) --------------------------------------------------------------------------------CBS-3ocoB03 B:291-346                                    Pfam domains (3)
           Pfam domains (4) --------------------------------------------------------------------------------CBS-3ocoB04 B:291-346                                    Pfam domains (4)
         Sec.struct. author .hhhhhhhhhhh.hhhhhhee......ee...hhhhhhhhhhhhh..eeeeee..eeeeeeeeeehhhhhhhhhhhh..hhhhh....eeee...hhhhhhhhhhhh....eeee.....eeeeehhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3oco B 211 ANFmQRAFEmNDKVASDVmVDRTSmSVVDVDETIADALLLYLEEQYSRFPVTADNDKDKIIGYAYNYDIVRQARIDDKAKISTImRDIVSVPENmKVPDVmEEmSAHRVPmAIVIDEYGGTSGIITDKDVYEELFG 346
                               |   220       230    |  240       250       260       270       280       290    |  300    |  310|  |   320|      330       340      
                             214-MSE |      229-MSE |                                                         295-MSE   305-MSE |  |      |                         
                                   220-MSE        235-MSE                                                                     311-MSE     |                         
                                                                                                                                 314-MSE  |                         
                                                                                                                                        321-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3OCO)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3OCO)

(-) Pfam Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: CBS] (51)
(-)
Family: CBS (51)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q04HE1_OENOB | Q04HE1)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0050660    flavin adenine dinucleotide binding    Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
    GO:0016614    oxidoreductase activity, acting on CH-OH group of donors    Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group act as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3oco)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3oco)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3oco
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q04HE1_OENOB | Q04HE1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q04HE1_OENOB | Q04HE1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3OCO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3OCO)