Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CYTOCHROME C PEROXIDASE BCCP OF SHEWANELLA ONEIDENSIS
 
Authors :  J. Seidel, O. Einsle
Date :  28 Jul 10  (Deposition) - 03 Aug 11  (Release) - 21 Sep 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Diheme Cytochrome, Hydrogen Peroxide, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. Schutz, J. Seidel, G. Sturm, O. Einsle, J. Gescher
Investigation Of The Electron Transport Chain To And The Catalytic Activity Of The Diheme Cytochrome C Peroxidase Ccpa Of Shewanella Oneidensis.
Appl. Environ. Microbiol. V. 77 6172 2011
PubMed-ID: 21742904  |  Reference-DOI: 10.1128/AEM.00606-11

(-) Compounds

Molecule 1 - CYTOCHROME C551 PEROXIDASE
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 23-333
    Gene: CCPA, SO_2178
    Organism Scientific: SHEWANELLA ONEIDENSIS
    Organism Taxid: 70863

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 13)

Asymmetric Unit (3, 13)
No.NameCountTypeFull Name
1BU31Ligand/Ion(R,R)-2,3-BUTANEDIOL
2CA4Ligand/IonCALCIUM ION
3HEM8Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
1BU3-1Ligand/Ion(R,R)-2,3-BUTANEDIOL
2CA-1Ligand/IonCALCIUM ION
3HEM4Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
Biological Unit 2 (2, 5)
No.NameCountTypeFull Name
1BU31Ligand/Ion(R,R)-2,3-BUTANEDIOL
2CA-1Ligand/IonCALCIUM ION
3HEM4Ligand/IonPROTOPORPHYRIN IX CONTAINING FE

(-) Sites  (13, 13)

Asymmetric Unit (13, 13)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREILE A:58 , SER A:59 , CYS A:60 , CYS A:63 , HIS A:64 , SER A:77 , ILE A:78 , ILE A:87 , SER A:89 , PRO A:90 , GLN A:101 , PHE A:102 , TRP A:103 , ARG A:106 , LEU A:110 , GLN A:113 , PRO A:117 , GLU A:123 , MET A:124 , ILE A:163 , GLU A:167 , LYS A:250 , HOH A:1008 , HOH A:1130 , HOH A:1133 , HOH A:1172 , HOH A:1276 , HOH A:1323BINDING SITE FOR RESIDUE HEM A 401
02AC2SOFTWARETRP A:103 , CYS A:204 , CYS A:207 , HIS A:208 , MET A:219 , MET A:221 , LEU A:223 , PHE A:249 , PRO A:252 , LEU A:254 , TYR A:263 , PHE A:264 , HIS A:265 , MET A:279 , GLN A:283 , HOH A:1002 , HOH A:1018 , HOH A:1054 , HOH A:1056BINDING SITE FOR RESIDUE HEM A 501
03AC3SOFTWAREASN A:88 , THR A:260 , PRO A:262 , HOH A:1001 , HOH A:1018 , HOH A:1056 , HOH A:1058BINDING SITE FOR RESIDUE CA A 601
04AC4SOFTWAREILE B:58 , CYS B:60 , CYS B:63 , HIS B:64 , SER B:77 , ILE B:78 , ILE B:87 , SER B:89 , PRO B:90 , VAL B:92 , GLN B:101 , PHE B:102 , TRP B:103 , ARG B:106 , LEU B:110 , GLN B:113 , PRO B:117 , GLU B:123 , MET B:124 , ILE B:163 , GLU B:167 , LYS B:250 , HOH B:1069 , HOH B:1140 , HOH B:1156 , HOH B:1179 , HOH B:1195 , HOH B:1225BINDING SITE FOR RESIDUE HEM B 402
05AC5SOFTWARETRP B:103 , CYS B:204 , CYS B:207 , HIS B:208 , MET B:219 , MET B:221 , LEU B:223 , PHE B:249 , PRO B:252 , LEU B:254 , ILE B:257 , TYR B:263 , PHE B:264 , HIS B:265 , MET B:279 , GLN B:283 , LEU B:284 , HOH B:1041 , HOH B:1059 , HOH B:1086 , HOH B:1094BINDING SITE FOR RESIDUE HEM B 502
06AC6SOFTWAREASN B:88 , THR B:260 , PRO B:262 , HOH B:1059 , HOH B:1072 , HOH B:1075 , HOH B:1086BINDING SITE FOR RESIDUE CA B 602
07AC7SOFTWAREILE C:58 , SER C:59 , CYS C:60 , CYS C:63 , HIS C:64 , SER C:77 , ILE C:78 , ILE C:87 , SER C:89 , PRO C:90 , VAL C:92 , GLN C:101 , PHE C:102 , TRP C:103 , ARG C:106 , LEU C:110 , GLN C:113 , PRO C:117 , GLU C:123 , MET C:124 , ILE C:163 , GLU C:167 , LYS C:250 , HOH C:1036 , HOH C:1066 , HOH C:1093 , HOH C:1101 , HOH C:1135 , HOH C:1260BINDING SITE FOR RESIDUE HEM C 403
08AC8SOFTWARETRP C:103 , CYS C:204 , CYS C:207 , HIS C:208 , MET C:219 , MET C:221 , LEU C:223 , PHE C:249 , PRO C:252 , LEU C:254 , ILE C:257 , TYR C:263 , PHE C:264 , HIS C:265 , VAL C:276 , MET C:279 , ALA C:280 , GLN C:283 , LEU C:284 , HOH C:1018 , HOH C:1030 , HOH C:1076 , HOH C:1088BINDING SITE FOR RESIDUE HEM C 503
09AC9SOFTWAREASN C:88 , THR C:260 , PRO C:262 , HOH C:1003 , HOH C:1007 , HOH C:1018 , HOH C:1088BINDING SITE FOR RESIDUE CA C 603
10BC1SOFTWAREGLU C:41 , LYS C:44 , ARG C:144 , PRO C:313 , ILE C:314 , HOH C:1033 , HOH C:1107 , HOH C:1170BINDING SITE FOR RESIDUE BU3 C 701
11BC2SOFTWAREILE D:58 , SER D:59 , CYS D:60 , CYS D:63 , HIS D:64 , SER D:77 , ILE D:78 , ILE D:87 , SER D:89 , PRO D:90 , VAL D:92 , GLN D:101 , PHE D:102 , TRP D:103 , ARG D:106 , LEU D:110 , GLN D:113 , PRO D:117 , GLU D:123 , MET D:124 , ILE D:163 , GLU D:167 , LYS D:250 , HOH D:1101 , HOH D:1102 , HOH D:1138 , HOH D:1140 , HOH D:1141BINDING SITE FOR RESIDUE HEM D 404
12BC3SOFTWARETRP D:103 , CYS D:204 , CYS D:207 , HIS D:208 , MET D:219 , MET D:221 , LEU D:223 , PHE D:249 , PRO D:252 , ILE D:257 , TYR D:263 , PHE D:264 , HIS D:265 , VAL D:276 , MET D:279 , GLN D:283 , LEU D:284 , MET D:296 , HOH D:1037 , HOH D:1063 , HOH D:1068 , HOH D:1071BINDING SITE FOR RESIDUE HEM D 504
13BC4SOFTWAREASN D:88 , THR D:260 , PRO D:262 , HOH D:1037 , HOH D:1041 , HOH D:1068 , HOH D:1113BINDING SITE FOR RESIDUE CA D 604

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3O5C)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Tyr A:261 -Pro A:262
2Tyr B:261 -Pro B:262
3Tyr C:261 -Pro C:262
4Tyr D:261 -Pro D:262

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3O5C)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3O5C)

(-) Exons   (0, 0)

(no "Exon" information available for 3O5C)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:308
 aligned with Q8EF24_SHEON | Q8EF24 from UniProtKB/TrEMBL  Length:333

    Alignment length:308
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323        
         Q8EF24_SHEON    24 EPIEVITPAKITEPEKVELGKMLFFEPRLSKSGFISCNSCHNLSTGGVDALPTSIGHHWQEGPINSPTVLNADFMLAQFWDGRASNLKEQAAGPIANPKEMGFTHELATETIASMPAYRARFAKVYGDEKVDIDRLTDAIAAFEKTLVTPNSPFDQYLLGKQDAISGDAKAGYQLFKDKGCVSCHNGPAVGGTMFMKMGLIKPFHTNNPAEGRKGVTGKDADKFVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLTEKETKEMVAFLNSLTGEQPQISLPILPPSNKETPRPVPFATG 331
               SCOP domains d3o5ca1 A:24-171 automated matches                                                                                                                  d3o5ca2 A:172-331 automated matches                                                                                                                              SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhhhhhh.....hhhhhh..............hhhhh..........hhhhh..........hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.....hhhhhhhh......hhhhhhhhhhhhhhhhhhh..........eee...............hhhhhhhhhhh.eee.....hhhhh..........hhhhhhhhhhhhhhh...hhhhhhhhhhhhhh............................. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3o5c A  24 EPIEVITPAKITEPEKVELGKMLFFEPRLSKSGFISCNSCHNLSTGGVDALPTSIGHHWQEGPINSPTVLNADFMLAQFWDGRASNLKEQAAGPIANPKEMGFTHELATETIASMPAYRARFAKVYGDEKVDIDRLTDAIAAFEKTLVTPNSPFDQYLLGKQDAISGDAKAGYQLFKDKGCVSCHNGPAVGGTMFMKMGLIKPFHTNNPAEGRKGVTGKDADKFVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLTEKETKEMVAFLNSLTGEQPQISLPILPPSNKETPRPVPFATG 331
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323        


Chain B from PDB  Type:PROTEIN  Length:307
 aligned with Q8EF24_SHEON | Q8EF24 from UniProtKB/TrEMBL  Length:333

    Alignment length:307
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       
         Q8EF24_SHEON    24 EPIEVITPAKITEPEKVELGKMLFFEPRLSKSGFISCNSCHNLSTGGVDALPTSIGHHWQEGPINSPTVLNADFMLAQFWDGRASNLKEQAAGPIANPKEMGFTHELATETIASMPAYRARFAKVYGDEKVDIDRLTDAIAAFEKTLVTPNSPFDQYLLGKQDAISGDAKAGYQLFKDKGCVSCHNGPAVGGTMFMKMGLIKPFHTNNPAEGRKGVTGKDADKFVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLTEKETKEMVAFLNSLTGEQPQISLPILPPSNKETPRPVPFAT 330
               SCOP domains d3o5cb1 B:24-171 automated matches                                                                                                                  d3o5cb2 B:172-330 automated matches                                                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhh.........hhhhh..........hhhhh..........hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh......hhhhhhhh......hhhhhhhhhhhhhhhhhhhh.........eee...............hhhhhhhhhhh.eee.....hhhhh..........hhhhhhhhhhhhhhh...hhhhhhhhhhhhhh............................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3o5c B  24 EPIEVITPAKITEPEKVELGKMLFFEPRLSKSGFISCNSCHNLSTGGVDALPTSIGHHWQEGPINSPTVLNADFMLAQFWDGRASNLKEQAAGPIANPKEMGFTHELATETIASMPAYRARFAKVYGDEKVDIDRLTDAIAAFEKTLVTPNSPFDQYLLGKQDAISGDAKAGYQLFKDKGCVSCHNGPAVGGTMFMKMGLIKPFHTNNPAEGRKGVTGKDADKFVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLTEKETKEMVAFLNSLTGEQPQISLPILPPSNKETPRPVPFAT 330
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       


Chain C from PDB  Type:PROTEIN  Length:304
 aligned with Q8EF24_SHEON | Q8EF24 from UniProtKB/TrEMBL  Length:333

    Alignment length:305
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323     
         Q8EF24_SHEON    24 EPIEVITPAKITEPEKVELGKMLFFEPRLSKSGFISCNSCHNLSTGGVDALPTSIGHHWQEGPINSPTVLNADFMLAQFWDGRASNLKEQAAGPIANPKEMGFTHELATETIASMPAYRARFAKVYGDEKVDIDRLTDAIAAFEKTLVTPNSPFDQYLLGKQDAISGDAKAGYQLFKDKGCVSCHNGPAVGGTMFMKMGLIKPFHTNNPAEGRKGVTGKDADKFVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLTEKETKEMVAFLNSLTGEQPQISLPILPPSNKETPRPVPF 328
               SCOP domains d3o5cc1 C :24-171 automated matches                                                                                                                 d3o5cc2 C:172-328 automated matches                                                                                                                           SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........-..hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhh.........hhhhh..........hhhhh..........hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.....hhhhhhhh......hhhhhhhhhhhhhhhhhhh..........eee...............hhhhhhhhhhh.eee.....hhhhh..........hhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.......................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3o5c C  24 EPIEVITPA-ITEPEKVELGKMLFFEPRLSKSGFISCNSCHNLSTGGVDALPTSIGHHWQEGPINSPTVLNADFMLAQFWDGRASNLKEQAAGPIANPKEMGFTHELATETIASMPAYRARFAKVYGDEKVDIDRLTDAIAAFEKTLVTPNSPFDQYLLGKQDAISGDAKAGYQLFKDKGCVSCHNGPAVGGTMFMKMGLIKPFHTNNPAEGRKGVTGKDADKFVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLTEKETKEMVAFLNSLTGEQPQISLPILPPSNKETPRPVPF 328
                                    |-|       43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323     
                                   32 |                                                                                                                                                                                                                                                                                                      
                                     34                                                                                                                                                                                                                                                                                                      


Chain D from PDB  Type:PROTEIN  Length:307
 aligned with Q8EF24_SHEON | Q8EF24 from UniProtKB/TrEMBL  Length:333

    Alignment length:307
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       
         Q8EF24_SHEON    24 EPIEVITPAKITEPEKVELGKMLFFEPRLSKSGFISCNSCHNLSTGGVDALPTSIGHHWQEGPINSPTVLNADFMLAQFWDGRASNLKEQAAGPIANPKEMGFTHELATETIASMPAYRARFAKVYGDEKVDIDRLTDAIAAFEKTLVTPNSPFDQYLLGKQDAISGDAKAGYQLFKDKGCVSCHNGPAVGGTMFMKMGLIKPFHTNNPAEGRKGVTGKDADKFVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLTEKETKEMVAFLNSLTGEQPQISLPILPPSNKETPRPVPFAT 330
               SCOP domains d3o5cd1 D:24-171 automated matches                                                                                                                  d3o5cd2 D:172-330 automated matches                                                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhhhhhh.....hhhhhh..............hhhhh..........hhhhh..........hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh......hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh.........eee...............hhhhhhhhhhh.eee.....hhhhh..........hhhhhhhhhhhhhhh...hhhhhhhhhhhhhh............................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3o5c D  24 EPIEVITPAKITEPEKVELGKMLFFEPRLSKSGFISCNSCHNLSTGGVDALPTSIGHHWQEGPINSPTVLNADFMLAQFWDGRASNLKEQAAGPIANPKEMGFTHELATETIASMPAYRARFAKVYGDEKVDIDRLTDAIAAFEKTLVTPNSPFDQYLLGKQDAISGDAKAGYQLFKDKGCVSCHNGPAVGGTMFMKMGLIKPFHTNNPAEGRKGVTGKDADKFVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLTEKETKEMVAFLNSLTGEQPQISLPILPPSNKETPRPVPFAT 330
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 8)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)
(-)
Fold: Cytochrome c (308)
(-)
Superfamily: Cytochrome c (308)
(-)
Family: automated matches (31)
(-)
Protein domain: automated matches (31)
(-)
Shewanella oneidensis [TaxId: 70863] (1)
1ad3o5ca1A:24-171
1bd3o5ca2A:172-331
1cd3o5cb1B:24-171
1dd3o5cb2B:172-330
1ed3o5cc1C:24-171
1fd3o5cc2C:172-328
1gd3o5cd1D:24-171
1hd3o5cd2D:172-330

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3O5C)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3O5C)

(-) Gene Ontology  (8, 8)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (Q8EF24_SHEON | Q8EF24)
molecular function
    GO:0004130    cytochrome-c peroxidase activity    Catalysis of the reaction: 2 ferrocytochrome c + hydrogen peroxide = 2 ferricytochrome c + 2 H2O.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0004601    peroxidase activity    Catalysis of the reaction: donor + hydrogen peroxide = oxidized donor + 2 H2O.
biological process
    GO:0098869    cellular oxidant detoxification    Any process carried out at the cellular level that reduces or removes the toxicity superoxide radicals or hydrogen peroxide.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BU3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Tyr A:261 - Pro A:262   [ RasMol ]  
    Tyr B:261 - Pro B:262   [ RasMol ]  
    Tyr C:261 - Pro C:262   [ RasMol ]  
    Tyr D:261 - Pro D:262   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3o5c
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8EF24_SHEON | Q8EF24
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8EF24_SHEON | Q8EF24
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3O5C)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3O5C)