Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A PUTATIVE CAFFEOYL-COA O-METHYLTRANSFERASE FROM STAPHYLOCOCCUS AUREUS
 
Authors :  W. Qiu, R. Lam, V. Romanov, K. Jones, E. F. Pai, N. Y. Chirgadze
Date :  05 Jul 10  (Deposition) - 06 Jul 11  (Release) - 06 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.55
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Rossmann Fold, Putative Methyltransferase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  W. Qiu, R. Lam, V. Romanov, K. Jones, E. F. Pai, N. Y. Chirgadze
Crystal Structure Of A Putative Caffeoyl-Coa O-Methyltransferase From Staphylococcus Aureus
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - MW1564 PROTEIN
    ChainsA, B
    EC Number2.1.1.104
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneMW1564
    Organism ScientificSTAPHYLOCOCCUS AUREUS
    Organism Taxid196620
    StrainMW2

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 13)

Asymmetric/Biological Unit (2, 13)
No.NameCountTypeFull Name
1MSE11Mod. Amino AcidSELENOMETHIONINE
2SO42Ligand/IonSULFATE ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREILE A:54 , VAL A:55 , GLU A:77 , THR A:80 , ALA A:81 , ILE A:82 , GLY A:83 , TYR A:84 , SER A:85 , HOH A:318 , HOH A:324 , HOH A:394BINDING SITE FOR RESIDUE SO4 A 233
2AC2SOFTWAREILE B:54 , VAL B:55 , GLU B:77 , THR B:80 , ALA B:81 , ILE B:82 , GLY B:83 , TYR B:84 , SER B:85 , HOH B:262 , HOH B:347 , HOH B:399BINDING SITE FOR RESIDUE SO4 B 233

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3NTV)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3NTV)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3NTV)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3NTV)

(-) Exons   (0, 0)

(no "Exon" information available for 3NTV)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:211
 aligned with A0A0H3JWL8_S | A0A0H3JWL8 from UniProtKB/TrEMBL  Length:212

    Alignment length:211
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210 
         A0A0H3JWL8_S     1 MDDLNKKYLIDLHQHQNSSIEVLREFAEVNEVPIVDRLTLDLIKQLIRMNNVKNILEIGTAIGYSSMQFASISDDIHVTTIERNETMIQYAKQNLATYHFENQVRIIEGNALEQFENVNDKVYDMIFIDAAKAQSKKFFEIYTPLLKHQGLVITDNVLYHGFVSDIGIVRSRNVRQMVKKVQDYNEWLIKQPGYTTNFLNIDDGLAISIKG 211
               SCOP domains d3ntva_ A: automated matches                                                                                                                                                                                        SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh..eeeee....hhhhhhhhh.....eeeeee.hhhhhhhhhhhhhhh.....eeeee.hhhhhhhhhh...eeeeeee....hhhhhhhhhh..eeeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeee.....eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ntv A  21 mDDLNKKYLIDLHQHQNSSIEVLREFAEVNEVPIVDRLTLDLIKQLIRmNNVKNILEIGTAIGYSSmQFASISDDIHVTTIERNETmIQYAKQNLATYHFENQVRIIEGNALEQFENVNDKVYDmIFIDAAKAQSKKFFEIYTPLLKHQGLVITDNVLYHGFVSDIGIVRSRNVRQmVKKVQDYNEWLIKQPGYTTNFLNIDDGLAISIKG 231
                            |       30        40        50        60        70        80      | 90       100      |110       120       130       140    |  150       160       170       180       190      |200       210       220       230 
                            |                                              69-MSE            87-MSE             107-MSE                               145-MSE                                             197-MSE                              
                           21-MSE                                                                                                                                                                                                              

Chain B from PDB  Type:PROTEIN  Length:209
 aligned with A0A0H3JWL8_S | A0A0H3JWL8 from UniProtKB/TrEMBL  Length:212

    Alignment length:209
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202         
         A0A0H3JWL8_S     3 DLNKKYLIDLHQHQNSSIEVLREFAEVNEVPIVDRLTLDLIKQLIRMNNVKNILEIGTAIGYSSMQFASISDDIHVTTIERNETMIQYAKQNLATYHFENQVRIIEGNALEQFENVNDKVYDMIFIDAAKAQSKKFFEIYTPLLKHQGLVITDNVLYHGFVSDIGIVRSRNVRQMVKKVQDYNEWLIKQPGYTTNFLNIDDGLAISIKG 211
               SCOP domains d3ntvb_ B: automated matches                                                                                                                                                                                      SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh..eeeee....hhhhhhhhh.....eeeeee.hhhhhhhhhhhhhhh.....eeeee.hhhhhhhhhh...eeeeeee....hhhhhhhhhh..eeeeeeeeee..hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh...eeeeee.....eeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ntv B  23 DLNKKYLIDLHQHQNSSIEVLREFAEVNEVPIVDRLTLDLIKQLIRmNNVKNILEIGTAIGYSSmQFASISDDIHVTTIERNETmIQYAKQNLATYHFENQVRIIEGNALEQFENVNDKVYDmIFIDAAKAQSKKFFEIYTPLLKHQGLVITDNVLYHGFVSDIGIVRSRNVRQmVKKVQDYNEWLIKQPGYTTNFLNIDDGLAISIKG 231
                                    32        42        52        62      | 72        82    |   92       102    |  112       122       132       142  |    152       162       172       182       192    |  202       212       222         
                                                                         69-MSE            87-MSE             107-MSE                               145-MSE                                             197-MSE                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3NTV)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3NTV)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3NTV)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3ntv)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3ntv
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0A0H3JWL8_S | A0A0H3JWL8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.104
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A0A0H3JWL8_S | A0A0H3JWL8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3NTV)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3NTV)