Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PUTATIVE TRANSCRIPTIONAL FACTOR LMO1026 FROM LISTERIA MONOCYTOGENES (FRAGMENT 52-321), NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET LMR194
 
Authors :  A. Kuzin, M. Su, J. Seetharaman, M. Mao, R. Xiao, C. Ciccosanti, D. Lee, J. K. Everett, R. Nair, T. B. Acton, B. Rost, G. T. Montelione, J. F. Hunt Northeast Structural Genomics Consortium (Nesg)
Date :  30 Jun 10  (Deposition) - 04 Aug 10  (Release) - 04 Aug 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  A (1x),B (1x)
Keywords :  Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Kuzin, M. Su, J. Seetharaman, M. Mao, R. Xiao, C. Ciccosanti, D. Lee, J. K. Everett, R. Nair, T. B. Acton, B. Rost, G. T. Montelione, J. F. Hunt L. Tong
Northeast Structural Genomics Consortium Target Lmr194
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - LMO1026 PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET 21-23C
    Expression System Strain: BL21(DE3)+ MAGIC
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: LMO1026
    Organism Scientific: LISTERIA MONOCYTOGENES
    Organism Taxid: 1639

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B
Biological Unit 3 (1x): A (1x)B (1x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 18)

Asymmetric Unit (1, 18)
No.NameCountTypeFull Name
1MSE18Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 9)
No.NameCountTypeFull Name
1MSE9Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 9)
No.NameCountTypeFull Name
1MSE9Mod. Amino AcidSELENOMETHIONINE
Biological Unit 3 (1, 9)
No.NameCountTypeFull Name
1MSE9Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3NRO)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3NRO)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3NRO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3NRO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3NRO)

(-) Exons   (0, 0)

(no "Exon" information available for 3NRO)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:235
 aligned with Q8Y889_LISMO | Q8Y889 from UniProtKB/TrEMBL  Length:321

    Alignment length:253
                                    77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317   
         Q8Y889_LISMO    68 EKKKPFSVLLMGSDARAGEKNGRADTIILATANKQQNAVEMVSIPRDTKVDYGNGDIGKINASYSNGGPSGTVSAVEKLMPGVPVDYFISINMEGFKDLVDAVGGITVYNDIDLTEVNSKFVKGNITLNGTEALQYVRIRHEDPRGDFGRQDRQRDVIIGIANKVISSSGVSNFESIMKAVGDNFQTNMTLTDITSMAANYSSVLKNVDSQELKGEGEMIYSESYGFDLYYFAPDKTDLERIITMFKKSLDIT 320
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeee.--------....eeeeeeee....eeeeeee....eee.....eee........hhhhhhhhhhhhh......eeeee..hhhhhhhhh......ee.............ee...hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh..----------.........eee..hhhhhhhhhhhh......eeeee..eeeeeee......eeeeeeehhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3nro A  68 EKKKPFSVLLmGS--------GRADTIILATANKQQNAVEmVSIPRDTKVDYGNGDIGKINASYSNGGPSGTVSAVEKLmPGVPVDYFISINmEGFKDLVDAVGGITVYNDIDLTEVNSKFVKGNITLNGTEALQYVRIRHEDPRGDFGRQDRQRDVIIGIANKV----------SImKAVGDNFQTNmTLTDITSmAANYSSVLKNVDSQELKGEGEmIYSESYGFDLYYFAPDKTDLERIITmFKKSLDIT 320
                                    77| |      - |      97       107|      117       127       137       147       157  |    167       177       187       197       207       217       227    |    -     | 247       257      |267       277       287       297       307    |  317   
                                     78-MSE     89                108-MSE                                147-MSE      160-MSE                                                                 232        243 |        256-MSE 264-MSE               286-MSE                   312-MSE    
                                       80                                                                                                                                                                  245-MSE                                                                       


Chain B from PDB  Type:PROTEIN  Length:237
 aligned with Q8Y889_LISMO | Q8Y889 from UniProtKB/TrEMBL  Length:321

    Alignment length:258
                                    72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312        
         Q8Y889_LISMO    63 TLSDLEKKKPFSVLLMGSDARAGEKNGRADTIILATANKQQNAVEMVSIPRDTKVDYGNGDIGKINASYSNGGPSGTVSAVEKLMPGVPVDYFISINMEGFKDLVDAVGGITVYNDIDLTEVNSKFVKGNITLNGTEALQYVRIRHEDPRGDFGRQDRQRDVIIGIANKVISSSGVSNFESIMKAVGDNFQTNMTLTDITSMAANYSSVLKNVDSQELKGEGEMIYSESYGFDLYYFAPDKTDLERIITMFKKSLDIT 320
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) -------------------        LytR_cpsA_psr-3nroB01 B:90-23     4                                                                                                              -        ----------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -------------------        LytR_cpsA_psr-3nroB02 B:90-23     4                                                                                                              -        ----------------------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author ..........eeeeeeee.--------...eeeeeeee....eeeeeee.......-----..hhhhhhhh.hhhhhhhhhhhhh......eeeeeehhhhhhhhhhh..eeeee.............eeeeehhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh..--------....hhhhh....hhhhhhhhhh..........eee..eeeeeee......eeeeeeehhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3nro B  63 TLSDLEKKKPFSVLLmGSD--------RADTIILATANKQQNAVEmVSIPRDTKVD-----IGKINASYSNGGPSGTVSAVEKLmPGVPVDYFISINmEGFKDLVDAVGGITVYNDIDLTEVNSKFVKGNITLNGTEALQYVRIRHEDPRGDFGRQDRQRDVIIGIANKVISS--------ImKAVGDNFQTNmTLTDITSmAANYSSVLKNVDSQELKGEGEmIYSESYGFDLYYFAPDKTDLERIITmFKKSLDIT 320
                                    72     |  |-       |92       102     | 112     |   - |     132       142    |  152       162       172       182       192       202       212       222       232  |      - ||    252   |   262 |     272       282   |   292       302       312        
                                          78-MSE      90               108-MSE   118   124                    147-MSE      160-MSE                                                                    235      244|        256-MSE 264-MSE               286-MSE                   312-MSE    
                                                                                                                                                                                                                245-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3NRO)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3NRO)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: no clan defined [family: LytR_cpsA_psr] (6)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q8Y889_LISMO | Q8Y889)
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3nro)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3nro)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3nro
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8Y889_LISMO | Q8Y889
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8Y889_LISMO | Q8Y889
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3NRO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3NRO)