|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3NR7) |
Sites (0, 0)| (no "Site" information available for 3NR7) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3NR7) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3NR7) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3NR7) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3NR7) |
Exons (0, 0)| (no "Exon" information available for 3NR7) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:81 aligned with HNS_SALTY | P0A1S2 from UniProtKB/Swiss-Prot Length:137 Alignment length:81 11 21 31 41 51 61 71 81 HNS_SALTY 2 SEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSMAAA 82 SCOP domains --------------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------- Transcript 3nr7 A 2 SEALKILNNIRTLRAQARESTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSMAAA 82 11 21 31 41 51 61 71 81 Chain B from PDB Type:PROTEIN Length:81 aligned with HNS_SALTY | P0A1S2 from UniProtKB/Swiss-Prot Length:137 Alignment length:81 11 21 31 41 51 61 71 81 HNS_SALTY 2 SEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSMAAA 82 SCOP domains --------------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------------- CATH domains Pfam domains (1) ----------------------Histone_HNS-3nr7B01 B:24-82 Pfam domains (1) Pfam domains (2) ----------------------Histone_HNS-3nr7B02 B:24-82 Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------- Transcript 3nr7 B 2 SEALKILNNIRTLRAQARESTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSMAAA 82 11 21 31 41 51 61 71 81
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3NR7) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3NR7) |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (9, 9)|
Asymmetric Unit(hide GO term definitions) Chain A,B (HNS_SALTY | P0A1S2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|