3NFF - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:99
 aligned with Q6FNZ9_CANGA | Q6FNZ9 from UniProtKB/TrEMBL  Length:407

    Alignment length:99
                                    15        25        35        45        55        65        75        85        95         
         Q6FNZ9_CANGA     6 SIAIDSYQEDPSVVVSNFFKGVRVPKDTEFQLYKKRKQDQFVLHGENERLEYDGETDELTTKTNQYVVGLYDKQSGKINLYRAPVVTSKIVSKFSKNLK 104
               SCOP domains --------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.....eeee...........eeeeeee.....eeeeee...eeeeee.hhhhhhheeeeeeeee....eeeeeee.eeeeeeee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------- Transcript
                 3nff A   6 SIAIDSYQEDPSVVVSNFFKGVRVPKDTEFQLYKKRKQDQFVLHGENERLEYDGETDELTTKTNQYMVGLYDKQSGKINLYRAPVVTSKIVSKFSKNLK 104
                                    15        25        35        45        55        65        75        85        95

Chain B from PDB  Type:PROTEIN  Length:110
 aligned with Q6FQI3_CANGA | Q6FQI3 from UniProtKB/TrEMBL  Length:243

    Alignment length:115
                                    34        44        54        64        74        84        94       104       114       124       134     
         Q6FQI3_CANGA    25 YQPPSDYKQCKHLKSFPVSELKGDNKELWLLKVPANIDISQLKSLPLDTDATVSTVELGSKNFNVLQNTSTQEGSDNTNLSLLIPSEKKKETLKVATSKDNKSVYFDRVFTISET 139
               SCOP domains ------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee.......hhhhh....eeeeeeeee...hhhhh.ee.......eeeeee..eeeeeee.hhh........eeeeee.--....eee....---.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                 3nff B  25 YQPPSDYKQCKHLKSFPVSELKGDNKELWLMKVPANIDISQLKSLPLDTDATVSTVELGSKNFNVLQNTSTQEGSDNTNLSLLIPS--KKETLKVATSK---SVYFDRVFTISET 139
                                    34        44        54        64        74        84        94       104     | 114        |-  |    134     
                                                                                                               110  |       123 127            
                                                                                                                  113

Chain C from PDB  Type:PROTEIN  Length:93
 aligned with Q6FNZ9_CANGA | Q6FNZ9 from UniProtKB/TrEMBL  Length:407

    Alignment length:93
                                    15        25        35        45        55        65        75        85        95   
         Q6FNZ9_CANGA     6 SIAIDSYQEDPSVVVSNFFKGVRVPKDTEFQLYKKRKQDQFVLHGENERLEYDGETDELTTKTNQYVVGLYDKQSGKINLYRAPVVTSKIVSK  98
               SCOP domains --------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.....eeee...........eeeeeee.....eeeeee...eeeeee.hhhhhhheeeeeeeee....eeeeee..eeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------- Transcript
                 3nff C   6 SIAIDSYQEDPSVVVSNFFKGVRVPKDTEFQLYKKRKQDQFVLHGENERLEYDGETDELTTKTNQYMVGLYDKQSGKINLYRAPVVTSKIVSK  98
                                    15        25        35        45        55        65        75        85        95

Chain D from PDB  Type:PROTEIN  Length:110
 aligned with Q6FQI3_CANGA | Q6FQI3 from UniProtKB/TrEMBL  Length:243

    Alignment length:115
                                    34        44        54        64        74        84        94       104       114       124       134     
         Q6FQI3_CANGA    25 YQPPSDYKQCKHLKSFPVSELKGDNKELWLLKVPANIDISQLKSLPLDTDATVSTVELGSKNFNVLQNTSTQEGSDNTNLSLLIPSEKKKETLKVATSKDNKSVYFDRVFTISET 139
               SCOP domains ------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee.......hhhhhhh..eeeeeeeee...hhhhh.ee.......eeeeee..eeeeeee.hhh........eeeeee.--...eeee....---.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                 3nff D  25 YQPPSDYKQCKHLKSFPVSELKGDNKELWLMKVPANIDISQLKSLPLDTDATVSTVELGSKNFNVLQNTSTQEGSDNTNLSLLIPS--KKETLKVATSK---SVYFDRVFTISET 139
                                    34        44        54        64        74        84        94       104     | 114        |-  |    134     
                                                                                                               110  |       123 127            
                                                                                                                  113

Chain E from PDB  Type:PROTEIN  Length:93
 aligned with Q6FNZ9_CANGA | Q6FNZ9 from UniProtKB/TrEMBL  Length:407

    Alignment length:93
                                    15        25        35        45        55        65        75        85        95   
         Q6FNZ9_CANGA     6 SIAIDSYQEDPSVVVSNFFKGVRVPKDTEFQLYKKRKQDQFVLHGENERLEYDGETDELTTKTNQYVVGLYDKQSGKINLYRAPVVTSKIVSK  98
               SCOP domains --------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.....eeee...........eeeeeee.....eeeeee...eeeeee.hhhhhhheeeeeeeee....eeeeee..eeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------- Transcript
                 3nff E   6 SIAIDSYQEDPSVVVSNFFKGVRVPKDTEFQLYKKRKQDQFVLHGENERLEYDGETDELTTKTNQYMVGLYDKQSGKINLYRAPVVTSKIVSK  98
                                    15        25        35        45        55        65        75        85        95

Chain F from PDB  Type:PROTEIN  Length:110
 aligned with Q6FQI3_CANGA | Q6FQI3 from UniProtKB/TrEMBL  Length:243

    Alignment length:115
                                    34        44        54        64        74        84        94       104       114       124       134     
         Q6FQI3_CANGA    25 YQPPSDYKQCKHLKSFPVSELKGDNKELWLLKVPANIDISQLKSLPLDTDATVSTVELGSKNFNVLQNTSTQEGSDNTNLSLLIPSEKKKETLKVATSKDNKSVYFDRVFTISET 139
               SCOP domains ------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee.......hhhhhhh..eeeeeeeee...hhhhh.ee.......eeee......eeeee.hhh........eeeeee.--....eee....---.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                 3nff F  25 YQPPSDYKQCKHLKSFPVSELKGDNKELWLMKVPANIDISQLKSLPLDTDATVSTVELGSKNFNVLQNTSTQEGSDNTNLSLLIPS--KKETLKVATSK---SVYFDRVFTISET 139
                                    34        44        54        64        74        84        94       104     | 114        |-  |    134     
                                                                                                               110  |       123 127            
                                                                                                                  113

Chain G from PDB  Type:PROTEIN  Length:93
 aligned with Q6FNZ9_CANGA | Q6FNZ9 from UniProtKB/TrEMBL  Length:407

    Alignment length:93
                                    15        25        35        45        55        65        75        85        95   
         Q6FNZ9_CANGA     6 SIAIDSYQEDPSVVVSNFFKGVRVPKDTEFQLYKKRKQDQFVLHGENERLEYDGETDELTTKTNQYVVGLYDKQSGKINLYRAPVVTSKIVSK  98
               SCOP domains --------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ----------------------RNA_pol_I_A49-3nffG01 G:28-98                                           Pfam domains (1)
           Pfam domains (2) ----------------------RNA_pol_I_A49-3nffG02 G:28-98                                           Pfam domains (2)
           Pfam domains (3) ----------------------RNA_pol_I_A49-3nffG03 G:28-98                                           Pfam domains (3)
           Pfam domains (4) ----------------------RNA_pol_I_A49-3nffG04 G:28-98                                           Pfam domains (4)
         Sec.struct. author .eeeeeee.....eeee...........eeeeeee.....eeeeee...eeeeee.hhhhhhheeeeeeeee....eeeeee..eeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------- Transcript
                 3nff G   6 SIAIDSYQEDPSVVVSNFFKGVRVPKDTEFQLYKKRKQDQFVLHGENERLEYDGETDELTTKTNQYMVGLYDKQSGKINLYRAPVVTSKIVSK  98
                                    15        25        35        45        55        65        75        85        95

Chain H from PDB  Type:PROTEIN  Length:111
 aligned with Q6FQI3_CANGA | Q6FQI3 from UniProtKB/TrEMBL  Length:243

    Alignment length:116
                                    34        44        54        64        74        84        94       104       114       124       134      
         Q6FQI3_CANGA    25 YQPPSDYKQCKHLKSFPVSELKGDNKELWLLKVPANIDISQLKSLPLDTDATVSTVELGSKNFNVLQNTSTQEGSDNTNLSLLIPSEKKKETLKVATSKDNKSVYFDRVFTISETA 140
               SCOP domains -------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---------------------RNA_polI_A34-3nffH01 H:46-140                                                                   Pfam domains (1)
           Pfam domains (2) ---------------------RNA_polI_A34-3nffH02 H:46-140                                                                   Pfam domains (2)
           Pfam domains (3) ---------------------RNA_polI_A34-3nffH03 H:46-140                                                                   Pfam domains (3)
           Pfam domains (4) ---------------------RNA_polI_A34-3nffH04 H:46-140                                                                   Pfam domains (4)
         Sec.struct. author ......eee.......hhhhhh...eeeeeeeee...hhhhh.ee.......eeee......eeeee............eeeeee.--...eeee....---.....eeeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------- Transcript
                 3nff H  25 YQPPSDYKQCKHLKSFPVSELKGDNKELWLMKVPANIDISQLKSLPLDTDATVSTVELGSKNFNVLQNTSTQEGSDNTNLSLLIPS--KKETLKVATSK---SVYFDRVFTISETA 140
                                    34        44        54        64        74        84        94       104     | 114        |-  |    134      
                                                                                                               110  |       123 127             
                                                                                                                  113

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,C,E,G (Q6FNZ9_CANGA | Q6FNZ9)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003899	DNA-directed 5'-3' RNA polymerase activity	Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
	GO:0001054	RNA polymerase I activity	Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template that contains an RNA polymerase I specific promoter to direct initiation and catalyzes DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
biological process
	GO:0006362	transcription elongation from RNA polymerase I promoter	The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase I specific promoter by the addition of ribonucleotides catalyzed by RNA polymerase I.
	GO:0006360	transcription from RNA polymerase I promoter	The synthesis of RNA from a DNA template by RNA polymerase I (RNAP I), originating at an RNAP I promoter.
	GO:0042790	transcription of nuclear large rRNA transcript from RNA polymerase I promoter	The synthesis of the large ribosomal RNA (rRNA) transcript which encodes several rRNAs, e.g. in mammals 28S, 18S and 5.8S, from a nuclear DNA template transcribed by RNA polymerase I.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005736	DNA-directed RNA polymerase I complex	RNA polymerase I, one of three nuclear DNA-directed RNA polymerases found in all eukaryotes, is a multisubunit complex; typically it produces rRNAs. Two large subunits comprise the most conserved portion including the catalytic site and share similarity with other eukaryotic and bacterial multisubunit RNA polymerases. The remainder of the complex is composed of smaller subunits (generally ten or more), some of which are also found in RNA polymerase III and others of which are also found in RNA polymerases II and III. Although the core is competent to mediate ribonucleic acid synthesis, it requires additional factors to select the appropriate template.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B,D,F,H (Q6FQI3_CANGA | Q6FQI3)

molecular function
	GO:0001054	RNA polymerase I activity	Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template that contains an RNA polymerase I specific promoter to direct initiation and catalyzes DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
biological process
	GO:0006362	transcription elongation from RNA polymerase I promoter	The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase I specific promoter by the addition of ribonucleotides catalyzed by RNA polymerase I.
	GO:0006360	transcription from RNA polymerase I promoter	The synthesis of RNA from a DNA template by RNA polymerase I (RNAP I), originating at an RNAP I promoter.
	GO:0042790	transcription of nuclear large rRNA transcript from RNA polymerase I promoter	The synthesis of the large ribosomal RNA (rRNA) transcript which encodes several rRNAs, e.g. in mammals 28S, 18S and 5.8S, from a nuclear DNA template transcribed by RNA polymerase I.
cellular component
	GO:0005736	DNA-directed RNA polymerase I complex	RNA polymerase I, one of three nuclear DNA-directed RNA polymerases found in all eukaryotes, is a multisubunit complex; typically it produces rRNAs. Two large subunits comprise the most conserved portion including the catalytic site and share similarity with other eukaryotic and bacterial multisubunit RNA polymerases. The remainder of the complex is composed of smaller subunits (generally ten or more), some of which are also found in RNA polymerase III and others of which are also found in RNA polymerases II and III. Although the core is competent to mediate ribonucleic acid synthesis, it requires additional factors to select the appropriate template.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (2, 8)

Gene Ontology (10, 17)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File