Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HISTIDYL-TRNA SYNTHETASE FROM NOSTOC SP. PCC 7120
 
Authors :  C. Chang, L. Bigelow, J. Carroll, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Date :  09 Jun 10  (Deposition) - 04 Aug 10  (Release) - 04 Aug 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Aminoacyl-Trna Synthetase, Ligase, Structural Genomics, Psi-2, Mcsg, Nostoc, Protein Structure Initiative, Midwest Center For Structural Genomics (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Chang, L. Bigelow, J. Carroll, A. Joachimiak
Crystal Structure Of Histidyl-Trna Synthetase From Nostoc Sp. Pcc 7120
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HISTIDYL-TRNA SYNTHETASE
    ChainsA, B
    EC Number6.1.1.21
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)MAGIC
    Expression System Taxid562
    Expression System Vector TypeMCSG19B
    GeneHISS, ALL5012
    Organism ScientificNOSTOC SP. PCC 7120
    Organism Taxid103690
    SynonymHISTIDINE--TRNA LIGASE, HISRS

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 11)

Asymmetric/Biological Unit (2, 11)
No.NameCountTypeFull Name
1ACT1Ligand/IonACETATE ION
2MSE10Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:176 , ASP A:251BINDING SITE FOR RESIDUE ACT A 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3NET)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Phe A:116 -Pro A:117
2Phe B:116 -Pro B:117

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3NET)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3NET)

(-) Exons   (0, 0)

(no "Exon" information available for 3NET)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:431
 aligned with SYH_NOSS1 | Q8YMC2 from UniProtKB/Swiss-Prot  Length:462

    Alignment length:456
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455      
            SYH_NOSS1     6 KINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIYGLEPILPPNRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGREKLSLLYDAQMPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLGVPDKRFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNTLPPTPAQVVVVNMQDELMPTYLKVSQQLRQAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRRL 461
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .............hhhhhhhhhhhhhhhhhhhhhh..ee.....eeehhhhhhhhh.--..eeeeeee.----------------..eee...hhhhhhhhhhhhhhhh...eeeee..eee...------..eeeeeeeeee.....hhhhhhhhhhhhhhhhhhhh...eeeeeeehhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..hhh.eee..........eeeeeeeeee..hhhhh...eeeee...hhhhh.....eeeeeeehhhhhhhhhhh............eee...hhhhhhhhhhhhhhhhhh...eee.....hhhhhhhhhhhhh..eeee.hhhhhhh...eeee....eeee..-.hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3net A   6 KINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQ--NIIYGLEPIL----------------EARALKFDQTVPLAAYIARHLNDLTFPFARYQmDVVFRGE------FRQFRQCDIDVVGREKLSLLYDAQmPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLGVPDKRFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGRYEELVGTFIGEKmPGVGISIGLTRLISRLLKAGILNTLPPTPAQVVVVNmQDELmPTYLKVSQQLRQAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVA-ADLAEEIKRRL 461
                                    15        25        35        45        55      | 65        |-         -     |  95       105       115       125    |    - |     145       155     | 165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335   |   345       355       365       375|    | 385       395       405       415       425       435       445   | | 455      
                                                                                   62 65       74               91                             123-MSE130    137                     161-MSE                                                                                                                                                                           339-MSE                              376-MSE|                                                                 449 |          
                                                                                                                                                                                                                                                                                                                                                                                                                 381-MSE                                                               451          

Chain B from PDB  Type:PROTEIN  Length:415
 aligned with SYH_NOSS1 | Q8YMC2 from UniProtKB/Swiss-Prot  Length:462

    Alignment length:455
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457     
            SYH_NOSS1     8 NFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIYGLEPILPPNRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGREKLSLLYDAQMPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLGVPDKRFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNTLPPTPAQVVVVNMQDELMPTYLKVSQQLRQAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRRLT 462
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ------tRNA-synt_His-3netB03 B:14-351                                                                                                                                                                                                                                                                                                                    ------------------HGTP_anticodon-3netB01 B:370-460                                                           -- Pfam domains (1)
           Pfam domains (2) ------tRNA-synt_His-3netB04 B:14-351                                                                                                                                                                                                                                                                                                                    ------------------HGTP_anticodon-3netB02 B:370-460                                                           -- Pfam domains (2)
         Sec.struct. author ...........hhhhhhhhhhhhhhhhhhhhhh..ee.....eeehhhhhh....-...eeeeeee.----------------..eee...hhhhhhhhhhhhhhhh...eeeee..eee...-----...eeeeeeeeee......hhhhhhhhhhhhhhhhhhh...eeeeeeehhhhhhhhh....hhhhhhhhh.......------........------...hhhhhh...hhhhhhhhhhhhhhhh--hhhhhhhhhhhhhhhhhhhhh..hhh.eee.....----.eeeeeeeeee..hhhhh...eeeee.............eeeeeeehhhhhhhhhhh............eee...hhhhhhhhhhhhhhhhhh...eee.....hhhhhhhhhhhh...eeee.hhhhhhh.eeeeee.....eeeeehhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3net B   8 NFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQ-DNIIYGLEPIL----------------EARALKFDQTVPLAAYIARHLNDLTFPFARYQmDVVFRGE-----RFRQFRQCDIDVVGREKLSLLYDAQmPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLE------VKLELEKE------TQKIIDFVKIDGSVDDVLDKLKHLSQTL--SEQFNLGVSELETVITGVRNLGVPDKRFCIDLAIA----YYTGTVYETTLIGHEALGSICSGGRYEELVGTFIGEKmPGVGISIGLTRLISRLLKAGILNTLPPTPAQVVVVNmQDELmPTYLKVSQQLRQAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRRLT 462
                                    17        27        37        47        57    | | 67      |  -         -   |    97       107       117     | 127  |    137       147       157   |   167       177       187       197       207    |    - |      |-     | 237       247       257  |  | 267       277       287       297    |  307       317       327       337 |     347       357       367       377   |   387       397       407       417       427       437       447       457     
                                                                                 62 |        74               91                             123-MSE130   136                      161-MSE                                            212    219    226    233                        260  |                               297  302                                  339-MSE                              376-MSE|                                                                                 
                                                                                   64                                                                                                                                                                                                    263                                                                                                                   381-MSE                                                                             

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3NET)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3NET)

(-) Pfam Domains  (2, 4)

Asymmetric/Biological Unit

(-) Gene Ontology  (9, 9)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (SYH_NOSS1 | Q8YMC2)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0004812    aminoacyl-tRNA ligase activity    Catalysis of the formation of aminoacyl-tRNA from ATP, amino acid, and tRNA with the release of diphosphate and AMP.
    GO:0004821    histidine-tRNA ligase activity    Catalysis of the reaction: ATP + L-histidine + tRNA(His) = AMP + diphosphate + L-histidyl-tRNA(His).
    GO:0016874    ligase activity    Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0006427    histidyl-tRNA aminoacylation    The process of coupling histidine to histidyl-tRNA, catalyzed by histidyl-tRNA synthetase. In tRNA aminoacylation, the amino acid is first activated by linkage to AMP and then transferred to either the 2'- or the 3'-hydroxyl group of the 3'-adenosine residue of the tRNA.
    GO:0006418    tRNA aminoacylation for protein translation    The synthesis of aminoacyl tRNA by the formation of an ester bond between the 3'-hydroxyl group of the most 3' adenosine of the tRNA, to be used in ribosome-mediated polypeptide synthesis.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Phe A:116 - Pro A:117   [ RasMol ]  
    Phe B:116 - Pro B:117   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3net
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SYH_NOSS1 | Q8YMC2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.1.1.21
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SYH_NOSS1 | Q8YMC2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3NET)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3NET)