|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 12)| Asymmetric/Biological Unit (3, 12) |
Sites (6, 6)
Asymmetric Unit (6, 6)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3N8B) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3N8B) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3N8B) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3N8B) |
Exons (0, 0)| (no "Exon" information available for 3N8B) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:75 aligned with O51076_BORBU | O51076 from UniProtKB/TrEMBL Length:122 Alignment length:75 12 22 32 42 52 62 72 O51076_BORBU 3 ERGEVYSEKLFTESERTYFFNVKENRKGDYFLNIVESKRSPSGDFERHSIFVYEENINEFESNLLKAIAVIKQKV 77 SCOP domains --------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------- Transcript 3n8b A 8 ERGEVYSEKmFTESERTYFmNVKENRKGDYFLNIVESKRSPSGDFERHSIFVYEENmNEFESNLLKAIAVIKQKV 82 17 27 37 47 57 | 67 77 17-MSE 27-MSE 64-MSE Chain B from PDB Type:PROTEIN Length:74 aligned with O51076_BORBU | O51076 from UniProtKB/TrEMBL Length:122 Alignment length:74 15 25 35 45 55 65 75 O51076_BORBU 6 EVYSEKLFTESERTYFFNVKENRKGDYFLNIVESKRSPSGDFERHSIFVYEENINEFESNLLKAIAVIKQKVST 79 SCOP domains -------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------- CATH domains Pfam domains (1) --DUF3276-3n8bB01 B:13-84 Pfam domains (1) Pfam domains (2) --DUF3276-3n8bB02 B:13-84 Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------- Transcript 3n8b B 11 EVYSEKmFTESERTYFmNVKENRKGDYFLNIVESKRSPSGDFERHSIFVYEENmNEFESNLLKAIAVIKQKVST 84 | 20 | 30 40 50 60 | 70 80 17-MSE 27-MSE 64-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3N8B) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3N8B) |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3N8B)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|