|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (5, 22)
Asymmetric Unit (5, 22)
|
Sites (16, 16)
Asymmetric Unit (16, 16)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3N84) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3N84) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3N84) |
PROSITE Motifs (2, 9)
Asymmetric Unit (2, 9)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (4, 21)
Asymmetric Unit (4, 21)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:109 aligned with GRB2_HUMAN | P62993 from UniProtKB/Swiss-Prot Length:217 Alignment length:109 64 74 84 94 104 114 124 134 144 154 GRB2_HUMAN 55 MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQA 163 SCOP domains d3n84a_ A: Growth factor receptor-bound protein 2 (GRB2) SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE SH3 -SH2 PDB: A:60-152 UniProt: 60-152 ---SH3 PROSITE Transcript 1 (1) 1.4 ----------------------------------------Exon 1.7 PDB: A:100-156 UniProt: 100-156 1.8b Transcript 1 (1) Transcript 1 (2) ----Exon 1.6 PDB: A:59-100 UniProt: 59-100 --------------------------------------------------------------- Transcript 1 (2) 3n84 A 55 MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQA 163 64 74 84 94 104 114 124 134 144 154 Chain B from PDB Type:PROTEIN Length:106 aligned with GRB2_HUMAN | P62993 from UniProtKB/Swiss-Prot Length:217 Alignment length:106 63 73 83 93 103 113 123 133 143 153 GRB2_HUMAN 54 EMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT 159 SCOP domains d3n84b_ B: Growth factor receptor-bound protein 2 (GRB2) SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE SH3 -SH2 PDB: B:60-152 UniProt: 60-152 ---SH3 PROSITE Transcript 1 (1) 1.4 ----------------------------------------Exon 1.7 PDB: B:100-156 UniProt: 100-156 1.8 Transcript 1 (1) Transcript 1 (2) -----Exon 1.6 PDB: B:59-100 UniProt: 59-100 ----------------------------------------------------------- Transcript 1 (2) 3n84 B 54 EMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT 159 63 73 83 93 103 113 123 133 143 153 Chain C from PDB Type:PROTEIN Length:109 aligned with GRB2_HUMAN | P62993 from UniProtKB/Swiss-Prot Length:217 Alignment length:109 64 74 84 94 104 114 124 134 144 154 GRB2_HUMAN 55 MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQA 163 SCOP domains d3n84c_ C: Growth factor receptor-bound protein 2 (GRB2) SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE SH3 -SH2 PDB: C:60-152 UniProt: 60-152 ---SH3 PROSITE Transcript 1 (1) 1.4 ----------------------------------------Exon 1.7 PDB: C:100-156 UniProt: 100-156 1.8b Transcript 1 (1) Transcript 1 (2) ----Exon 1.6 PDB: C:59-100 UniProt: 59-100 --------------------------------------------------------------- Transcript 1 (2) 3n84 C 55 MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQA 163 64 74 84 94 104 114 124 134 144 154 Chain D from PDB Type:PROTEIN Length:101 aligned with GRB2_HUMAN | P62993 from UniProtKB/Swiss-Prot Length:217 Alignment length:101 63 73 83 93 103 113 123 133 143 153 GRB2_HUMAN 54 EMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQV 154 SCOP domains d3n84d_ D: Growth factor receptor-bound protein 2 (GRB2) SCOP domains CATH domains ----------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE SH3 -SH2 PDB: D:60-152 UniProt: 60-152 -- PROSITE Transcript 1 (1) 1.4 ----------------------------------------Exon 1.7 PDB: D:100-154 UniProt: 100-156 [INCOMPLETE] Transcript 1 (1) Transcript 1 (2) -----Exon 1.6 PDB: D:59-100 UniProt: 59-100 ------------------------------------------------------ Transcript 1 (2) 3n84 D 54 EMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQV 154 63 73 83 93 103 113 123 133 143 153 Chain E from PDB Type:PROTEIN Length:102 aligned with GRB2_HUMAN | P62993 from UniProtKB/Swiss-Prot Length:217 Alignment length:102 61 71 81 91 101 111 121 131 141 151 GRB2_HUMAN 52 YIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ 153 SCOP domains d3n84e_ E: Growth factor receptor-bound protein 2 (GRB2) SCOP domains CATH domains ------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE SH3 -SH2 PDB: E:60-152 UniProt: 60-152 - PROSITE Transcript 1 (1) Exon 1.4----------------------------------------Exon 1.7 PDB: E:100-153 UniProt: 100-156 [INCOMPLETE] Transcript 1 (1) Transcript 1 (2) -------Exon 1.6 PDB: E:59-100 UniProt: 59-100 ----------------------------------------------------- Transcript 1 (2) 3n84 E 52 MIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ 153 61 71 81 91 101 111 121 131 141 151 Chain F from PDB Type:PROTEIN Length:101 aligned with GRB2_HUMAN | P62993 from UniProtKB/Swiss-Prot Length:217 Alignment length:101 62 72 82 92 102 112 122 132 142 152 GRB2_HUMAN 53 IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ 153 SCOP domains d3n84f_ F: Growth factor receptor-bound protein 2 (GRB2) SCOP domains CATH domains ----------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) -------SH2-3n84F01 F:60-135 ------------------ Pfam domains (1) Pfam domains (2) -------SH2-3n84F02 F:60-135 ------------------ Pfam domains (2) Pfam domains (3) -------SH2-3n84F03 F:60-135 ------------------ Pfam domains (3) Pfam domains (4) -------SH2-3n84F04 F:60-135 ------------------ Pfam domains (4) Pfam domains (5) -------SH2-3n84F05 F:60-135 ------------------ Pfam domains (5) Pfam domains (6) -------SH2-3n84F06 F:60-135 ------------------ Pfam domains (6) SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE SH3 -SH2 PDB: F:60-152 UniProt: 60-152 - PROSITE Transcript 1 (1) 1.4 ----------------------------------------Exon 1.7 PDB: F:100-153 UniProt: 100-156 [INCOMPLETE] Transcript 1 (1) Transcript 1 (2) ------Exon 1.6 PDB: F:59-100 UniProt: 59-100 ----------------------------------------------------- Transcript 1 (2) 3n84 F 53 IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ 153 62 72 82 92 102 112 122 132 142 152
Chain G from PDB Type:PROTEIN Length:6
SCOP domains ------ SCOP domains
CATH domains ------ CATH domains
Pfam domains ------ Pfam domains
SAPs(SNPs) ------ SAPs(SNPs)
PROSITE ------ PROSITE
Transcript ------ Transcript
3n84 G 1 yVNVPx 6
| |
1-PTR|
6-011
Chain H from PDB Type:PROTEIN Length:6
SCOP domains ------ SCOP domains
CATH domains ------ CATH domains
Pfam domains ------ Pfam domains
SAPs(SNPs) ------ SAPs(SNPs)
PROSITE ------ PROSITE
Transcript ------ Transcript
3n84 H 1 yVNVPx 6
| |
| |
1-PTR|
6-011
Chain I from PDB Type:PROTEIN Length:6
SCOP domains ------ SCOP domains
CATH domains ------ CATH domains
Pfam domains ------ Pfam domains
SAPs(SNPs) ------ SAPs(SNPs)
PROSITE ------ PROSITE
Transcript ------ Transcript
3n84 I 1 yVNVPx 6
| |
| |
1-PTR|
6-011
Chain J from PDB Type:PROTEIN Length:6
SCOP domains ------ SCOP domains
CATH domains ------ CATH domains
Pfam domains ------ Pfam domains
SAPs(SNPs) ------ SAPs(SNPs)
PROSITE ------ PROSITE
Transcript ------ Transcript
3n84 J 1 yVNVPx 6
| |
| |
1-PTR|
6-011
Chain K from PDB Type:PROTEIN Length:6
SCOP domains ------ SCOP domains
CATH domains ------ CATH domains
Pfam domains ------ Pfam domains
SAPs(SNPs) ------ SAPs(SNPs)
PROSITE ------ PROSITE
Transcript ------ Transcript
3n84 K 1 yVNVPx 6
| |
| |
1-PTR|
6-011
Chain L from PDB Type:PROTEIN Length:6
SCOP domains ------ SCOP domains
CATH domains ------ CATH domains
Pfam domains ------ Pfam domains
SAPs(SNPs) ------ SAPs(SNPs)
PROSITE ------ PROSITE
Transcript ------ Transcript
3n84 L 1 yVNVPx 6
| |
| |
1-PTR|
6-011
|
||||||||||||||||||||
SCOP Domains (1, 6)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3N84) |
Pfam Domains (1, 6)
Asymmetric Unit
|
Gene Ontology (57, 57)|
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D,E,F (GRB2_HUMAN | P62993)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|