Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF CSM1/LRS4 COMPLEX
 
Authors :  K. D. Corbett, S. C. Harrison
Date :  27 May 10  (Deposition) - 01 Sep 10  (Release) - 01 Sep 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.90
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F
Keywords :  Meiosis, Rdna, Replication (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. D. Corbett, C. K. Yip, L. S. Ee, T. Walz, A. Amon, S. C. Harrison
The Monopolin Complex Crosslinks Kinetochore Components To Regulate Chromosome-Microtubule Attachments.
Cell(Cambridge, Mass. ) V. 142 556 2010
PubMed-ID: 20723757  |  Reference-DOI: 10.1016/J.CELL.2010.07.017

(-) Compounds

Molecule 1 - MONOPOLIN COMPLEX SUBUNIT CSM1
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPST39
    Expression System StrainROSETTA 2 PLYSS
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneCSM1, SPO86, YCR086W, YCR86W
    Organism CommonBREWER'S YEAST,LAGER BEER YEAST,YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymCHROMOSOME SEGREGATION IN MEIOSIS PROTEIN 1
 
Molecule 2 - MONOPOLIN COMPLEX SUBUNIT LRS4
    ChainsE, F
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPST39
    Expression System StrainROSETTA 2 PLYSS
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 1-102, DELTA 38-44
    GeneD9461.25, LRS4, YDR439W
    Organism CommonBREWER'S YEAST,LAGER BEER YEAST,YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymLOSS OF RDNA SILENCING PROTEIN 4

 Structural Features

(-) Chains, Units

  123456
Asymmetric/Biological Unit ABCDEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3N7N)

(-) Sites  (0, 0)

(no "Site" information available for 3N7N)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3N7N)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3N7N)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3N7N)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3N7N)

(-) Exons   (0, 0)

(no "Exon" information available for 3N7N)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:163
 aligned with CSM1_YEAST | P25651 from UniProtKB/Swiss-Prot  Length:190

    Alignment length:177
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       
           CSM1_YEAST     3 PLTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSGGSSDDYSIMDYKLGFVKGQAQVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL 179
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhee....ee....eeeeeee...---------.eeeeeeee-----..eeeeee.....hhhhhhhhhhhhhhhhhh.eeehhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3n7n A   3 PLTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTH---------IMDYKLGFV-----VTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL 179
                                    12        22        32        42        52        62        72        82        92       102  |      -  |    122|     |132       142       152       162       172       
                                                                                                                                105       115     123   129                                                  

Chain B from PDB  Type:PROTEIN  Length:164
 aligned with CSM1_YEAST | P25651 from UniProtKB/Swiss-Prot  Length:190

    Alignment length:176
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173      
           CSM1_YEAST     4 LTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSGGSSDDYSIMDYKLGFVKGQAQVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL 179
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.ee...ee....eeeeee.------------..eeeeeee.......eeeeee.....hhhhhhhhhhhhhhhhh..eeee..hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3n7n B   4 LTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQ------------IMDYKLGFVKGQAQVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL 179
                                    13        23        33        43        53        63        73        83        93        |-         - |     123       133       143       153       163       173      
                                                                                                                            102          115                                                                

Chain C from PDB  Type:PROTEIN  Length:158
 aligned with CSM1_YEAST | P25651 from UniProtKB/Swiss-Prot  Length:190

    Alignment length:172
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177  
           CSM1_YEAST     8 KNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSGGSSDDYSIMDYKLGFVKGQAQVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL 179
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.ee....ee....eeeeeee...---------.eeeeeeee-----..eeeeee.....hhhhhhhhhhhhhhhhhh.eeehhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3n7n C   8 KNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTH---------IMDYKLGFV-----VTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL 179
                                    17        27        37        47        57        67        77        87        97       | -       117     |   - |     137       147       157       167       177  
                                                                                                                           105       115     123   129                                                  

Chain D from PDB  Type:PROTEIN  Length:158
 aligned with CSM1_YEAST | P25651 from UniProtKB/Swiss-Prot  Length:190

    Alignment length:177
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       
           CSM1_YEAST     3 PLTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSGGSSDDYSIMDYKLGFVKGQAQVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL 179
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --------------------------------------------------------------------Csm1-3n7nD01 D:71-167                                                                            ------------ Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------Csm1-3n7nD02 D:71-167                                                                            ------------ Pfam domains (2)
           Pfam domains (3) --------------------------------------------------------------------Csm1-3n7nD03 D:71-167                                                                            ------------ Pfam domains (3)
           Pfam domains (4) --------------------------------------------------------------------Csm1-3n7nD04 D:71-167                                                                            ------------ Pfam domains (4)
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...ee...ee....eeeeee-------------...eeeee.------..eeeee.....hhhhhhhhhhhh..........hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3n7n D   3 PLTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDIS-------------IMDYKLGFV------TEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL 179
                                    12        22        32        42        52        62        72        82        92        |-         -  |    122|      132       142       152       162       172       
                                                                                                                            101           115     123    130                                                 

Chain E from PDB  Type:PROTEIN  Length:31
 aligned with LRS4_YEAST | Q04087 from UniProtKB/Swiss-Prot  Length:347

    Alignment length:31
                                    12        22        32 
           LRS4_YEAST     3 TLLQLLSNYYKAKLDSERIYNEYVQSQYEFA  33
               SCOP domains ------------------------------- SCOP domains
               CATH domains ------------------------------- CATH domains
               Pfam domains ------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------- PROSITE
                 Transcript ------------------------------- Transcript
                 3n7n E   3 TLLQLLSNYYKAKLDSERIYNEYVQSQYEFA  33
                                    12        22        32 

Chain F from PDB  Type:PROTEIN  Length:30
 aligned with LRS4_YEAST | Q04087 from UniProtKB/Swiss-Prot  Length:347

    Alignment length:30
                                    12        22        32
           LRS4_YEAST     3 TLLQLLSNYYKAKLDSERIYNEYVQSQYEF  32
               SCOP domains ------------------------------ SCOP domains
               CATH domains ------------------------------ CATH domains
           Pfam domains (1) --LRS4-3n7nF01 F:5-32          Pfam domains (1)
           Pfam domains (2) --LRS4-3n7nF02 F:5-32          Pfam domains (2)
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                 3n7n F   3 TLLQLLSNYYKAKLDSERIYNEYVQSQYEF  32
                                    12        22        32

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3N7N)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3N7N)

(-) Pfam Domains  (2, 6)

Asymmetric/Biological Unit

(-) Gene Ontology  (22, 33)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (CSM1_YEAST | P25651)
molecular function
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:1990644    microtubule site clamp    The binding activity of a molecule that attaches the spindle microtubules to the kinetochore.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0051315    attachment of mitotic spindle microtubules to kinetochore    The cell cycle process in which spindle microtubules become physically associated with the proteins making up the kinetochore complex as part of mitotic metaphase plate congression.
    GO:0045143    homologous chromosome segregation    The cell cycle process in which replicated homologous chromosomes are organized and then physically separated and apportioned to two sets during the first division of the meiotic cell cycle. Each replicated chromosome, composed of two sister chromatids, aligns at the cell equator, paired with its homologous partner; this pairing off, referred to as synapsis, permits genetic recombination. One homolog (both sister chromatids) of each morphologic type goes into each of the resulting chromosome sets.
    GO:0051321    meiotic cell cycle    Progression through the phases of the meiotic cell cycle, in which canonically a cell replicates to produce four offspring with half the chromosomal content of the progenitor cell via two nuclear divisions.
    GO:0045132    meiotic chromosome segregation    The process in which genetic material, in the form of chromosomes, is organized into specific structures and then physically separated and apportioned to two or more sets during M phase of the meiotic cell cycle.
    GO:0045144    meiotic sister chromatid segregation    The cell cycle process in which sister chromatids are organized and then physically separated and randomly apportioned to two sets during the second division of the meiotic cell cycle.
    GO:0034503    protein localization to nucleolar rDNA repeats    Any process in which a protein is transported to, or maintained at, the rDNA repeats on a chromosome in the nucleolus.
    GO:0070550    rDNA condensation    The process in which the chromatin structure of the rDNA repeats is compacted. In S. cerevisiae, condensation and resolution of the rDNA occurs during anaphase.
cellular component
    GO:0005694    chromosome    A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
    GO:0034506    chromosome, centromeric core domain    The innermost portion of the centromeric region of a chromosome, encompassing the core region of a chromosome centromere and the proteins that bind to it.
    GO:0000775    chromosome, centromeric region    The region of a chromosome that includes the centromeric DNA and associated proteins. In monocentric chromosomes, this region corresponds to a single area of the chromosome, whereas in holocentric chromosomes, it is evenly distributed along the chromosome.
    GO:0000778    condensed nuclear chromosome kinetochore    A multisubunit complex that is located at the centromeric region of a condensed nuclear chromosome and provides an attachment point for the spindle microtubules.
    GO:0072686    mitotic spindle    A spindle that forms as part of mitosis. Mitotic and meiotic spindles contain distinctive complements of proteins associated with microtubules.
    GO:0033551    monopolin complex    A protein complex required for clamping microtubule binding sites, ensuring orientation of sister kinetochores to the same pole (mono-orientation) during meiosis I. In the yeast S. cerevisiae this complex consists of Csm1p, Lrs4p, Hrr25p and Mam1p; in S. pombe Psc1 and Mde4 have been identified as subunits.
    GO:0005635    nuclear envelope    The double lipid bilayer enclosing the nucleus and separating its contents from the rest of the cytoplasm; includes the intermembrane space, a gap of width 20-40 nm (also called the perinuclear space).
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain E,F   (LRS4_YEAST | Q04087)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0000183    chromatin silencing at rDNA    Repression of transcription of ribosomal DNA by altering the structure of chromatin.
    GO:0045143    homologous chromosome segregation    The cell cycle process in which replicated homologous chromosomes are organized and then physically separated and apportioned to two sets during the first division of the meiotic cell cycle. Each replicated chromosome, composed of two sister chromatids, aligns at the cell equator, paired with its homologous partner; this pairing off, referred to as synapsis, permits genetic recombination. One homolog (both sister chromatids) of each morphologic type goes into each of the resulting chromosome sets.
    GO:0051321    meiotic cell cycle    Progression through the phases of the meiotic cell cycle, in which canonically a cell replicates to produce four offspring with half the chromosomal content of the progenitor cell via two nuclear divisions.
    GO:0034503    protein localization to nucleolar rDNA repeats    Any process in which a protein is transported to, or maintained at, the rDNA repeats on a chromosome in the nucleolus.
    GO:0070550    rDNA condensation    The process in which the chromatin structure of the rDNA repeats is compacted. In S. cerevisiae, condensation and resolution of the rDNA occurs during anaphase.
cellular component
    GO:0005694    chromosome    A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
    GO:0000775    chromosome, centromeric region    The region of a chromosome that includes the centromeric DNA and associated proteins. In monocentric chromosomes, this region corresponds to a single area of the chromosome, whereas in holocentric chromosomes, it is evenly distributed along the chromosome.
    GO:0033551    monopolin complex    A protein complex required for clamping microtubule binding sites, ensuring orientation of sister kinetochores to the same pole (mono-orientation) during meiosis I. In the yeast S. cerevisiae this complex consists of Csm1p, Lrs4p, Hrr25p and Mam1p; in S. pombe Psc1 and Mde4 have been identified as subunits.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3n7n)
 
  Sites
(no "Sites" information available for 3n7n)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3n7n)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3n7n
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CSM1_YEAST | P25651
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  LRS4_YEAST | Q04087
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CSM1_YEAST | P25651
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  LRS4_YEAST | Q04087
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CSM1_YEAST | P256513n4r 3n4s 3n4x 5ktb 5v1a 5v3n

(-) Related Entries Specified in the PDB File

3n4r STRUCTURE OF CSM1 C-TERMINAL DOMAIN, R3 FORM
3n4s STRUCTURE OF CSM1 C-TERMINAL DOMAIN, P21212 FORM
3n4x STRUCTURE OF CSM1 FULL-LENGTH