3MUC - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   MUCONATE CYCLOISOMERASE VARIANT I54V

Authors :   U. Schell, S. Helin, T. Kajander, M. Schlomann, A. Goldman

Date :   27 Oct 98 (Deposition) - 04 Nov 99 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (4x)

Keywords :   Muconate Cycloisomerase, Substrate Specificity, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   U. Schell, S. Helin, T. Kajander, M. Schlomann, A. Goldman
Structural Basis For The Activity Of Two Muconate Cycloisomerase Variants Toward Substituted Muconates.
Proteins V. 34 125 1999
PubMed-ID: 10336378 | Reference-DOI: 10.1002/(SICI)1097-0134(19990101)34:1<125::AID-PROT 10>3.3.CO;2-P
(for further references see the PDB file header)

Molecule 1 - PROTEIN (MUCONATE CYCLOISOMERASE)
	Chains	:	A, B
	EC Number	:	5.5.1.1
	Mutation	:	YES
	Organism Scientific	:	PSEUDOMONAS PUTIDA
	Organism Taxid	:	303
	Strain	:	PRS2000
	Synonym	:	MUCONATE LACTONIZING ENZYME

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (4x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	MN	2	Ligand/Ion	MANGANESE (II) ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	MN	-1	Ligand/Ion	MANGANESE (II) ION

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:198 , GLU A:224 , ASP A:249 , HOH A:3060 , HOH A:3110 , HOH A:3140	BINDING SITE FOR RESIDUE MN A 380
2	AC2	SOFTWARE	ASP B:198 , GLU B:224 , ASP B:249 , HOH B:4062 , HOH B:4079 , HOH B:4103	BINDING SITE FOR RESIDUE MN B 381

(no "SS Bond" information available for 3MUC)

(no "Cis Peptide Bond" information available for 3MUC)

(no "SAP(SNP)/Variant" information available for 3MUC)

Asymmetric Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	MR_MLE_1	PS00908	Mandelate racemase / muconate lactonizing enzyme family signature 1.	CATB_PSEPU	106-131	2	A:104-129 B:104-129
2	MR_MLE_2	PS00909	Mandelate racemase / muconate lactonizing enzyme family signature 2.	CATB_PSEPU	197-228	2	A:195-226 B:195-226

Biological Unit 1 (2, 16)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	MR_MLE_1	PS00908	Mandelate racemase / muconate lactonizing enzyme family signature 1.	CATB_PSEPU	106-131	8	A:104-129 B:104-129
2	MR_MLE_2	PS00909	Mandelate racemase / muconate lactonizing enzyme family signature 2.	CATB_PSEPU	197-228	8	A:195-226 B:195-226

(no "Exon" information available for 3MUC)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:360
 aligned with CATB_PSEPU | P08310 from UniProtKB/Swiss-Prot  Length:375

    Alignment length:371
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373 
           CATB_PSEPU     4 VLIERIEAIIVHDLPTIRPPHKLAMHTMQTQTLVLIRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALVGLPADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEAQHMLEIRRHRVFKLKIGANPLAQDLKHVVAIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRSGQVRLNQRSPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIALYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR 374
               SCOP domains d3muca2 A:4 -130 M          uconate-lactonizing enzyme (cis muconate cycloisomerase)                                             d3muca1 A:131-372 Muconate-lactonizing enzyme                                                                                                                                                                                                      SCOP domains
               CATH domains 3mucA01 A:4 -121,A          :358-371 Enolase-like, N-terminal domain                                                    3mucA02 A:122-357 Enolase superfamily                                                                                                                                                                                                       3mucA01       - CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee-eee...----------.eeeeeeeeeee....eeeeeee...........hhhhhhhhhh.hhhhh.......hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh...hhhh.......eee..eee....hhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhhhhhh.eeeee......hhhhhhhhhhhhhh...eee.......hhhhhhhhhh...eee.......hhhhhhhhhh....eeee.hhhh..hhhhhhhhhhhhhh..eeee......hhhhhhhhhhhhh...........hhhh..........eee..eee............hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------MR_MLE_1  PDB: A:104-129  -----------------------------------------------------------------MR_MLE_2  PDB: A:195-226        -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3muc A   4 ALIERIDAIIV-DLPTIR----------QQQTLVVLRVRCSDGVEGIGEATTVGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR 372
                                    13| |    | -        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371 
                                     14 |   20         30                                                                                                                                                                                                                                                                                                                                                      
                                       15

Chain B from PDB  Type:PROTEIN  Length:360
 aligned with CATB_PSEPU | P08310 from UniProtKB/Swiss-Prot  Length:375

    Alignment length:371
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373 
           CATB_PSEPU     4 VLIERIEAIIVHDLPTIRPPHKLAMHTMQTQTLVLIRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALVGLPADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEAQHMLEIRRHRVFKLKIGANPLAQDLKHVVAIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRSGQVRLNQRSPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIALYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR 374
               SCOP domains d3mucb2 B:4 -130 M          uconate-lactonizing enzyme (cis muconate cycloisomerase)                                             d3mucb1 B:131-372 Muconate-lactonizing enzyme                                                                                                                                                                                                      SCOP domains
               CATH domains 3mucB01 B:4 -121,B          :358-371 Enolase-like, N-terminal domain                                                    3mucB02 B:122-357 Enolase superfamily                                                                                                                                                                                                       3mucB01       - CATH domains
           Pfam domains (1) ----MR_MLE_ N-3muc          B01 B:8-129                                                                                         -----------------------------------------------------------------------------------------------------------------------MR_MLE_C-3mucB03 B:249-361                                                                                       ----------- Pfam domains (1)
           Pfam domains (2) ----MR_MLE_ N-3muc          B02 B:8-129                                                                                         -----------------------------------------------------------------------------------------------------------------------MR_MLE_C-3mucB04 B:249-361                                                                                       ----------- Pfam domains (2)
         Sec.struct. author ..eeeeeeeee-eee...----------.eeeeeeeeeee....eeeeeee...........hhhhhhhhhh.hhhhh.......hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh...hhhh.......eee..eee....hhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhhhhhh.eeeee......hhhhhhhhhhhhhh...eee.......hhhhhhhhhh...eee.......hhhhhhhhhh....eeee.hhhh..hhhhhhhhhhhhhh..eeee......hhhhhhhhhhhhh...........hhhh..........eee..eee............hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------MR_MLE_1  PDB: B:104-129  -----------------------------------------------------------------MR_MLE_2  PDB: B:195-226        -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3muc B   4 ALIERIDAIIV-DLPTIR----------QQQTLVVLRVRCSDGVEGIGEATTVGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR 372
                                    13| |    | -        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371 
                                     14 |   20         30                                                                                                                                                                                                                                                                                                                                                      
                                       15

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Enolase-like; domain 1 (252)

Homologous Superfamily: Enolase-like, N-terminal domain (130)

Pseudomonas putida. Organism_taxid: 303. Strain: prs2000 (3)

1a	3mucA01	A:4-121,A:358-371
1b	3mucB01	B:4-121,B:358-371

Architecture: Alpha-Beta Barrel (2994)

Topology: TIM Barrel (2806)

Homologous Superfamily: Enolase superfamily (142)

Pseudomonas putida. Organism_taxid: 303. Strain: prs2000 (3)

2a	3mucA02	A:122-357
2b	3mucB02	B:122-357

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Enolase_N (69)

Family: MR_MLE_N (47)

Pseudomonas putida (Arthrobacter siderocapsulatus) (8)

1a	MR_MLE_N-3mucB01	B:8-129
1b	MR_MLE_N-3mucB02	B:8-129

Clan: Enolase_TIM (82)

Family: MR_MLE_C (29)

Pseudomonas putida (Arthrobacter siderocapsulatus) (3)

2a	MR_MLE_C-3mucB03	B:249-361
2b	MR_MLE_C-3mucB04	B:249-361

Asymmetric Unit(hide GO term definitions)

Chain A,B (CATB_PSEPU | P08310)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0018850	chloromuconate cycloisomerase activity	Catalysis of the reaction: 2-chloro-2,5-dihydro-5-oxofuran-2-acetate = 3-chloro-cis,cis-muconate.
	GO:0016853	isomerase activity	Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
	GO:0030145	manganese ion binding	Interacting selectively and non-covalently with manganese (Mn) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0018849	muconate cycloisomerase activity	Catalysis of the reaction: 2,5-dihydro-5-oxofuran-2-acetate = cis,cis-hexadienedioate.
biological process
	GO:0019439	aromatic compound catabolic process	The chemical reactions and pathways resulting in the breakdown of aromatic compounds, any substance containing an aromatic carbon ring.
	GO:0042952	beta-ketoadipate pathway	A pathway of aromatic compound degradation by ortho-cleavage; one branch converts protocatechuate, derived from phenolic compounds, to beta-ketoadipate, and the other branch converts catechol, generated from various aromatic hydrocarbons, amino aromatics, and lignin monomers, also to beta-ketoadipate. Two additional steps accomplish the conversion of beta-ketoadipate to tricarboxylic acid cycle intermediates.
	GO:0009063	cellular amino acid catabolic process	The chemical reactions and pathways resulting in the breakdown of amino acids, organic acids containing one or more amino substituents.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3muc)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3muc
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CATB_PSEPU \| P08310
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	5.5.1.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CATB_PSEPU \| P08310
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CATB_PSEPU \| P08310	:	1muc 2muc

(no "Related Entries Specified in the PDB File" available for 3MUC)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 4)

Pfam Domains (2, 4)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File