Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ADENYLATE/GUANYLATE CYCLASE/HYDROLASE FROM SILICIBACTER POMEROYI
 
Authors :  Y. Kim, H. Li, S. Clancy, A. Joachimiak, Midwest Center For Structur Genomics (Mcsg)
Date :  28 Apr 10  (Deposition) - 23 Jun 10  (Release) - 23 Jun 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C  (2x)
Keywords :  Alpha-Beta Fold, Structural Genomics, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Kim, H. Li, S. Clancy, A. Joachimiak
Crystal Structure Of Adenylate/Guanylate Cyclase/Hydrolase From Silicibacter Pomeroyi
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - ADENYLATE/GUANYLATE CYCLASE/HYDROLASE, ALPHA/BETA FOLD FAMILY
    ChainsA, B, C
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPMCSG19
    Expression System StrainBL21 MAGIC
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    FragmentRESIDUES 2-187
    GeneSPO3024
    Organism ScientificRUEGERIA POMEROYI
    Organism Taxid246200
    StrainDSS-3

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (1x)AB 
Biological Unit 2 (2x)  C

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 12)

Asymmetric Unit (1, 12)
No.NameCountTypeFull Name
1MSE12Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 8)
No.NameCountTypeFull Name
1MSE8Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 8)
No.NameCountTypeFull Name
1MSE8Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3MR7)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3MR7)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3MR7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3MR7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3MR7)

(-) Exons   (0, 0)

(no "Exon" information available for 3MR7)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:173
 aligned with Q5LP28_RUEPO | Q5LP28 from UniProtKB/TrEMBL  Length:465

    Alignment length:173
                             1                                                                                                                                                                           
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169   
         Q5LP28_RUEPO     - -MERRLCAILAADMAGYSRLMERNETDVLNRQKLYRRELIDPAIAQAGGQIVKTTGDGMLARFDTAQAALRCALEIQQAMQQREEDTPRKERIQYRIGINIGDIVLEDGDIFGDAVNVAARLEAISEPGAICVSDIVHQITQDRVSEPFTDLGLQKVKNITRPIRVWQWVPDA 172
               SCOP domains d3mr7a_ A: automated matches                                                                                                                                                  SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeee...hhhhh..hhhhhhhhhhhhhhhhhhhhhhh..eeeeee..eeeeee.hhhhhhhhhhhhhhhhhhhh...hhhhh..eeeeeeeeeeee....eehhhhhhhhhhhhhh....eeeehhhhhhhh.......eeeeeeee..eeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3mr7 A  -1 NAERRLCAILAADmAGYSRLmERNETDVLNRQKLYRRELIDPAIAQAGGQIVKTTGDGmLARFDTAQAALRCALEIQQAmQQREEDTPRKERIQYRIGINIGDIVLEDGDIFGDAVNVAARLEAISEPGAICVSDIVHQITQDRVSEPFTDLGLQKVKNITRPIRVWQWVPDA 171
                                     8   |    18|       28        38        48        58        68        78        88        98       108       118       128       138       148       158       168   
                                        12-MSE 19-MSE                                57-MSE               78-MSE                                                                                         

Chain B from PDB  Type:PROTEIN  Length:172
 aligned with Q5LP28_RUEPO | Q5LP28 from UniProtKB/TrEMBL  Length:465

    Alignment length:172
                             1                                                                                                                                                                          
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169  
         Q5LP28_RUEPO     - -MERRLCAILAADMAGYSRLMERNETDVLNRQKLYRRELIDPAIAQAGGQIVKTTGDGMLARFDTAQAALRCALEIQQAMQQREEDTPRKERIQYRIGINIGDIVLEDGDIFGDAVNVAARLEAISEPGAICVSDIVHQITQDRVSEPFTDLGLQKVKNITRPIRVWQWVPD 171
               SCOP domains d3mr7b_ B: automated matches                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeee.........hhhhhhhhhhhhhhhhhhhhhhhh..eeeeee..eeeeee.hhhhhhhhhhhhhhhhhhh....hhhhh..eeeeeeeeeeeee..eeehhhhhhhhhhhhhh....eeeehhhhhhhh.......eeeeee........eeeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3mr7 B  -1 NAERRLCAILAADmAGYSRLmERNETDVLNRQKLYRRELIDPAIAQAGGQIVKTTGDGmLARFDTAQAALRCALEIQQAmQQREEDTPRKERIQYRIGINIGDIVLEDGDIFGDAVNVAARLEAISEPGAICVSDIVHQITQDRVSEPFTDLGLQKVKNITRPIRVWQWVPD 170
                                     8   |    18|       28        38        48        58        68        78        88        98       108       118       128       138       148       158       168  
                                        12-MSE 19-MSE                                57-MSE               78-MSE                                                                                        

Chain C from PDB  Type:PROTEIN  Length:169
 aligned with Q5LP28_RUEPO | Q5LP28 from UniProtKB/TrEMBL  Length:465

    Alignment length:172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  
         Q5LP28_RUEPO     1 MERRLCAILAADMAGYSRLMERNETDVLNRQKLYRRELIDPAIAQAGGQIVKTTGDGMLARFDTAQAALRCALEIQQAMQQREEDTPRKERIQYRIGINIGDIVLEDGDIFGDAVNVAARLEAISEPGAICVSDIVHQITQDRVSEPFTDLGLQKVKNITRPIRVWQWVPDA 172
               SCOP domains d3mr7c_ C: automated    matches                                                                                                                                              SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeee......---hhhhhhhhhhhhhhhhhhhhhhh..eeeeee..eeeeee.hhhhhhhhhhhhhhhhhhhhh..hhhhh.eeeeeeeeeeeeee..eeehhhhhhhhhhhhhh....eeeehhhhhhhhhhh....eeeeee........eeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3mr7 C   0 AERRLCAILAADmAGYSRLm---ETDVLNRQKLYRRELIDPAIAQAGGQIVKTTGDGmLARFDTAQAALRCALEIQQAmQQREEDTPRKERIQYRIGINIGDIVLEDGDIFGDAVNVAARLEAISEPGAICVSDIVHQITQDRVSEPFTDLGLQKVKNITRPIRVWQWVPDA 171
                                     9  |     19   |    29        39        49       |59        69        79        89        99       109       119       129       139       149       159       169  
                                       12-MSE 19-MSE                                57-MSE               78-MSE                                                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3MR7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3MR7)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C   (Q5LP28_RUEPO | Q5LP28)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016849    phosphorus-oxygen lyase activity    Catalysis of the cleavage of a phosphorus-oxygen bond by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond.
biological process
    GO:0009190    cyclic nucleotide biosynthetic process    The chemical reactions and pathways resulting in the formation of a cyclic nucleotide, a nucleotide in which the phosphate group is in diester linkage to two positions on the sugar residue.
    GO:0035556    intracellular signal transduction    The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3mr7)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3mr7)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3mr7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5LP28_RUEPO | Q5LP28
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q5LP28_RUEPO | Q5LP28
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3MR7)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3MR7)