|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3M8J) |
Sites (0, 0)| (no "Site" information available for 3M8J) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3M8J) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3M8J) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3M8J) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3M8J) |
Exons (0, 0)| (no "Exon" information available for 3M8J) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:90 aligned with Q93K76_ECOLX | Q93K76 from UniProtKB/TrEMBL Length:109 Alignment length:90 19 29 39 49 59 69 79 89 99 Q93K76_ECOLX 10 GGDAFLLKLRESALSSGSMSEEQFFLLIGISSIHSDRVILAMKDYLVSGHSRKDVCEKYQMNNGYFSTTLGRLTRLNVLVARLAPYYTDS 99 SCOP domains ------------------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------ Transcript 3m8j A 10 GGDAFLLKLRESALSSGSMSEEQFFLLIGISSIHSDRVILAMKDYLVSGHSRKDVCEKYQMNNGYFSTTLGRLTRLNVLVARLAPYYTDS 99 19 29 39 49 59 69 79 89 99 Chain B from PDB Type:PROTEIN Length:88 aligned with Q93K76_ECOLX | Q93K76 from UniProtKB/TrEMBL Length:109 Alignment length:88 19 29 39 49 59 69 79 89 Q93K76_ECOLX 10 GGDAFLLKLRESALSSGSMSEEQFFLLIGISSIHSDRVILAMKDYLVSGHSRKDVCEKYQMNNGYFSTTLGRLTRLNVLVARLAPYYT 97 SCOP domains ---------------------------------------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------------------------------------- CATH domains Pfam domains (1) PapB-3m8jB01 B:10-96 - Pfam domains (1) Pfam domains (2) PapB-3m8jB02 B:10-96 - Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------- Transcript 3m8j B 10 GGDAFLLKLRESALSSGSMSEEQFFLLIGISSIHSDRVILAMKDYLVSGHSRKDVCEKYQMNNGYFSTTLGRLTRLNVLVARLAPYYT 97 19 29 39 49 59 69 79 89
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3M8J) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3M8J) |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (1, 1)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q93K76_ECOLX | Q93K76)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|