![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 3M20) |
(no "Site" information available for 3M20) |
(no "SS Bond" information available for 3M20) |
(no "Cis Peptide Bond" information available for 3M20) |
(no "SAP(SNP)/Variant" information available for 3M20) |
(no "PROSITE Motif" information available for 3M20) |
(no "Exon" information available for 3M20) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:59 aligned with O29588_ARCFU | O29588 from UniProtKB/TrEMBL Length:63 Alignment length:59 11 21 31 41 51 O29588_ARCFU 2 PVLIVYGPKLDVGKKREFVERLTSVAAEIYGMDRSAITILIHEPPAENVGVGGKLIADR 60 SCOP domains ----------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------- Transcript 3m20 A 1 PVLIVYGPKLDVGKKREFVERLTSVAAEIYGMDRSAITILIHEPPAENVGVGGKLIADR 59 10 20 30 40 50 Chain B from PDB Type:PROTEIN Length:58 aligned with O29588_ARCFU | O29588 from UniProtKB/TrEMBL Length:63 Alignment length:58 11 21 31 41 51 O29588_ARCFU 2 PVLIVYGPKLDVGKKREFVERLTSVAAEIYGMDRSAITILIHEPPAENVGVGGKLIAD 59 SCOP domains ---------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------- Transcript 3m20 B 1 PVLIVYGPKLDVGKKREFVERLTSVAAEIYGMDRSAITILIHEPPAENVGVGGKLIAD 58 10 20 30 40 50 Chain C from PDB Type:PROTEIN Length:58 aligned with O29588_ARCFU | O29588 from UniProtKB/TrEMBL Length:63 Alignment length:58 11 21 31 41 51 O29588_ARCFU 2 PVLIVYGPKLDVGKKREFVERLTSVAAEIYGMDRSAITILIHEPPAENVGVGGKLIAD 59 SCOP domains ---------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------- CATH domains Pfam domains (1) Tautomerase-3m20C01 C:1-58 Pfam domains (1) Pfam domains (2) Tautomerase-3m20C02 C:1-58 Pfam domains (2) Pfam domains (3) Tautomerase-3m20C03 C:1-58 Pfam domains (3) SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------- Transcript 3m20 C 1 PVLIVYGPKLDVGKKREFVERLTSVAAEIYGMDRSAITILIHEPPAENVGVGGKLIAD 58 10 20 30 40 50
|
(no "SCOP Domain" information available for 3M20) |
(no "CATH Domain" information available for 3M20) |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B,C (O29588_ARCFU | O29588)
|
|
|
|
|
|
|