|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3M20) |
Sites (0, 0)| (no "Site" information available for 3M20) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3M20) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3M20) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3M20) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3M20) |
Exons (0, 0)| (no "Exon" information available for 3M20) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:59 aligned with O29588_ARCFU | O29588 from UniProtKB/TrEMBL Length:63 Alignment length:59 11 21 31 41 51 O29588_ARCFU 2 PVLIVYGPKLDVGKKREFVERLTSVAAEIYGMDRSAITILIHEPPAENVGVGGKLIADR 60 SCOP domains ----------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------- Transcript 3m20 A 1 PVLIVYGPKLDVGKKREFVERLTSVAAEIYGMDRSAITILIHEPPAENVGVGGKLIADR 59 10 20 30 40 50 Chain B from PDB Type:PROTEIN Length:58 aligned with O29588_ARCFU | O29588 from UniProtKB/TrEMBL Length:63 Alignment length:58 11 21 31 41 51 O29588_ARCFU 2 PVLIVYGPKLDVGKKREFVERLTSVAAEIYGMDRSAITILIHEPPAENVGVGGKLIAD 59 SCOP domains ---------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------- Transcript 3m20 B 1 PVLIVYGPKLDVGKKREFVERLTSVAAEIYGMDRSAITILIHEPPAENVGVGGKLIAD 58 10 20 30 40 50 Chain C from PDB Type:PROTEIN Length:58 aligned with O29588_ARCFU | O29588 from UniProtKB/TrEMBL Length:63 Alignment length:58 11 21 31 41 51 O29588_ARCFU 2 PVLIVYGPKLDVGKKREFVERLTSVAAEIYGMDRSAITILIHEPPAENVGVGGKLIAD 59 SCOP domains ---------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------- CATH domains Pfam domains (1) Tautomerase-3m20C01 C:1-58 Pfam domains (1) Pfam domains (2) Tautomerase-3m20C02 C:1-58 Pfam domains (2) Pfam domains (3) Tautomerase-3m20C03 C:1-58 Pfam domains (3) SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------- Transcript 3m20 C 1 PVLIVYGPKLDVGKKREFVERLTSVAAEIYGMDRSAITILIHEPPAENVGVGGKLIAD 58 10 20 30 40 50
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3M20) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3M20) |
Pfam Domains (1, 3)
Asymmetric Unit
|
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A,B,C (O29588_ARCFU | O29588)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|