3LZ6 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   GUINEA PIG 11BETA HYDROXYSTEROID DEHYDROGENASE WITH PF-877423

Authors :   T. A. Pauly

Date :   01 Mar 10 (Deposition) - 04 May 11 (Release) - 04 May 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.84

Chains :   Asym./Biol. Unit : A,B,C,D

Keywords :   Oxidoreductase-Oxidoreductase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. Cheng, J. Hoffman, P. Le, S. K. Nair, S. Cripps, J. Matthews, C. Smith M. Yang, S. Kupchinsky, K. Dress, M. Edwards, B. Cole, E. Walters, C. Loh, J. Ermolieff, A. Fanjul, G. B. Bhat, J. Herrera, T. Pauly, N. Hosea, G. Paderes, P. Rejto
The Development And Sar Of Pyrrolidine Carboxamide 11Beta-Hsd1 Inhibitors.
Bioorg. Med. Chem. Lett. V. 20 2897 2010
PubMed-ID: 20363126 | Reference-DOI: 10.1016/J.BMCL.2010.03.032

Molecule 1 - CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
	Chains	:	A, B, C, D
	EC Number	:	1.1.1.146
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	LUMINAL DOMAIN
	Gene	:	HSD11B1
	Mutation	:	YES
	Organism Common	:	GUINEA PIG
	Organism Scientific	:	CAVIA PORCELLUS
	Organism Taxid	:	10141
	Synonym	:	11-BETA-HYDROXYSTEROID DEHYDROGENASE 1, 11-DH, 11-BETA-HSD1

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 8)

No.	Name	Count	Type	Full Name
1	A0D	4	Ligand/Ion	N-ADAMANTAN-2-YL-1-ETHYL-D-PROLINAMIDE
2	NAP	4	Ligand/Ion	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:16 , ALA A:17 , SER A:18 , LYS A:19 , GLY A:20 , ILE A:21 , ALA A:40 , ARG A:41 , SER A:42 , SER A:67 , MET A:68 , ASN A:94 , HIS A:95 , VAL A:96 , VAL A:143 , SER A:144 , SER A:145 , TYR A:158 , LYS A:162 , LEU A:190 , GLY A:191 , LEU A:192 , ILE A:193 , THR A:195 , THR A:197 , ALA A:198 , A0D A:2004 , HOH A:2027 , HOH A:2372 , HOH C:2261	BINDING SITE FOR RESIDUE NAP A 2000
2	AC2	SOFTWARE	GLY B:279 , SER B:281 , GLY B:283 , ILE B:284 , ALA B:303 , ARG B:304 , SER B:305 , GLY B:329 , SER B:330 , MET B:331 , ASN B:357 , HIS B:358 , VAL B:359 , VAL B:406 , SER B:407 , SER B:408 , TYR B:421 , LYS B:425 , LEU B:453 , GLY B:454 , LEU B:455 , ILE B:456 , THR B:458 , THR B:460 , ALA B:461 , A0D B:2005 , HOH B:2100 , HOH B:2130 , HOH B:2143 , HOH B:2332	BINDING SITE FOR RESIDUE NAP B 2001
3	AC3	SOFTWARE	GLY C:542 , ALA C:543 , SER C:544 , GLY C:546 , ILE C:547 , ALA C:566 , ARG C:567 , SER C:568 , SER C:593 , MET C:594 , ASN C:620 , HIS C:621 , VAL C:622 , VAL C:669 , SER C:670 , SER C:671 , TYR C:684 , LYS C:688 , LEU C:716 , GLY C:717 , LEU C:718 , ILE C:719 , THR C:721 , THR C:723 , ALA C:724 , A0D C:2006 , HOH C:2074 , HOH C:2083 , HOH C:2097	BINDING SITE FOR RESIDUE NAP C 2002
4	AC4	SOFTWARE	GLY D:805 , ALA D:806 , SER D:807 , LYS D:808 , GLY D:809 , ILE D:810 , ALA D:829 , ARG D:830 , SER D:831 , GLY D:855 , SER D:856 , MET D:857 , ASN D:883 , VAL D:885 , VAL D:932 , SER D:933 , SER D:934 , TYR D:947 , LYS D:951 , LEU D:979 , GLY D:980 , LEU D:981 , ILE D:982 , THR D:984 , THR D:986 , ALA D:987 , A0D D:2007 , HOH D:2030 , HOH D:2050 , HOH D:2102 , HOH D:2124 , HOH D:2299	BINDING SITE FOR RESIDUE NAP D 2003
5	AC5	SOFTWARE	ASN A:99 , SER A:145 , TYR A:158 , LEU A:192 , ALA A:198 , NAP A:2000	BINDING SITE FOR RESIDUE A0D A 2004
6	AC6	SOFTWARE	SER B:408 , TYR B:421 , GLY B:454 , LEU B:455 , ALA B:461 , NAP B:2001	BINDING SITE FOR RESIDUE A0D B 2005
7	AC7	SOFTWARE	SER C:671 , TYR C:684 , LEU C:718 , ALA C:724 , THR C:728 , NAP C:2002	BINDING SITE FOR RESIDUE A0D C 2006
8	AC8	SOFTWARE	SER D:934 , TYR D:941 , TYR D:947 , GLY D:980 , LEU D:981 , ALA D:987 , NAP D:2003	BINDING SITE FOR RESIDUE A0D D 2007

(no "SS Bond" information available for 3LZ6)

(no "Cis Peptide Bond" information available for 3LZ6)

(no "SAP(SNP)/Variant" information available for 3LZ6)

Asymmetric/Biological Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ADH_SHORT	PS00061	Short-chain dehydrogenases/reductases family signature.	DHI1_CAVPO	170-198	4	A:145-173 B:408-436 C:671-699 D:934-962

(no "Exon" information available for 3LZ6)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:263
 aligned with DHI1_CAVPO | Q6QLL4 from UniProtKB/Swiss-Prot  Length:300

    Alignment length:263
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285   
          DHI1_CAVPO     26 KFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEFLSAAEYNWDN  288
               SCOP domains d3lz6a_ A: 11-beta-hydroxysteroid dehydrogenase 1                                                                                                                                                                                                                       SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..eeee....hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh..eeeeee....hhhhhhhhhhhhhhhhh...eeee.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee.hhh.....hhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee....hhhhhhhhh........hhhhhhhhhhhhhhh...eeee....hhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ADH_SHORT  PDB: A:145-173    ------------------------------------------------------------------------------------------ PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3lz6 A    1 KFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEFLSAAEYNWDN  263
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260

Chain B from PDB  Type:PROTEIN  Length:263
 aligned with DHI1_CAVPO | Q6QLL4 from UniProtKB/Swiss-Prot  Length:300

    Alignment length:263
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285   
          DHI1_CAVPO     26 KFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEFLSAAEYNWDN  288
               SCOP domains d3lz6b_ B: 11-beta-hydroxysteroid dehydrogenase 1                                                                                                                                                                                                                       SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..eeee....hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh..eeeeee....hhhhhhhhhhhhhhhhh...eeee.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee.hhh.....hhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee....hhhhhhhhh........hhhhhhhhhhhhhhh...eeee....hhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ADH_SHORT  PDB: B:408-436    ------------------------------------------------------------------------------------------ PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3lz6 B  264 KFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEFLSAAEYNWDN  526
                                   273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523

Chain C from PDB  Type:PROTEIN  Length:263
 aligned with DHI1_CAVPO | Q6QLL4 from UniProtKB/Swiss-Prot  Length:300

    Alignment length:263
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285   
          DHI1_CAVPO     26 KFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEFLSAAEYNWDN  288
               SCOP domains d3lz6c_ C: 11-beta-hydroxysteroid dehydrogenase 1                                                                                                                                                                                                                       SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..eeee....hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh...eeeeee....hhhhhhhhhhhhhhhhh...eeee.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee.hhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee....hhhhhhhhh........hhhhhhhhhhhhhhh...eeee....hhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ADH_SHORT  PDB: C:671-699    ------------------------------------------------------------------------------------------ PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3lz6 C  527 KFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEFLSAAEYNWDN  789
                                   536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776       786

Chain D from PDB  Type:PROTEIN  Length:263
 aligned with DHI1_CAVPO | Q6QLL4 from UniProtKB/Swiss-Prot  Length:300

    Alignment length:263
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285   
          DHI1_CAVPO     26 KFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEFLSAAEYNWDN  288
               SCOP domains d3lz6d_ D: 11-beta-hydroxysteroid dehydrogenase 1                                                                                                                                                                                                                       SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---------adh_short-3lz6D01 D:799-966                                                                                                                                             -------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ---------adh_short-3lz6D02 D:799-966                                                                                                                                             -------------------------------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) ---------adh_short-3lz6D03 D:799-966                                                                                                                                             -------------------------------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) ---------adh_short-3lz6D04 D:799-966                                                                                                                                             -------------------------------------------------------------------------------------- Pfam domains (4)
         Sec.struct. author ..hhhhhh..eeee....hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh..eeeeee....hhhhhhhhhhhhhhhhh...eeee.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee.hhh.....hhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee....hhhhhhhhh........hhhhhhhhhhhhhhh...eeee....hhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ADH_SHORT  PDB: D:934-962    ------------------------------------------------------------------------------------------ PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3lz6 D  790 KFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEFLSAAEYNWDN 1052
                                   799       809       819       829       839       849       859       869       879       889       899       909       919       929       939       949       959       969       979       989       999      1009      1019      1029      1039      1049

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: NAD(P)-binding Rossmann-fold domains (1604)

Superfamily: NAD(P)-binding Rossmann-fold domains (1604)

Family: Tyrosine-dependent oxidoreductases (503)

Protein domain: 11-beta-hydroxysteroid dehydrogenase 1 (34)

Guinea pig (Cavia porcellus) [TaxId: 10141] (4)

1a	d3lz6a_	A:
1b	d3lz6b_	B:
1c	d3lz6c_	C:
1d	d3lz6d_	D:

(no "CATH Domain" information available for 3LZ6)

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: NADP_Rossmann (1239)

Family: adh_short (92)

Cavia porcellus (Guinea pig) (2)

1a	adh_short-3lz6D01	D:799-966
1b	adh_short-3lz6D02	D:799-966
1c	adh_short-3lz6D03	D:799-966
1d	adh_short-3lz6D04	D:799-966

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D (DHI1_CAVPO | Q6QLL4)

molecular function
	GO:0070524	11-beta-hydroxysteroid dehydrogenase (NADP+) activity	Catalysis of the reaction: an 11-beta-hydroxysteroid + NADP+ = an 11-oxosteroid + NADPH + H+.
	GO:0003845	11-beta-hydroxysteroid dehydrogenase [NAD(P)] activity	Catalysis of the reaction: an 11-beta-hydroxysteroid + NAD(P)+ = an 11-oxosteroid + NAD(P)H + H(+).
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0030324	lung development	The process whose specific outcome is the progression of the lung over time, from its formation to the mature structure. In all air-breathing vertebrates the lungs are developed from the ventral wall of the oesophagus as a pouch which divides into two sacs. In amphibians and many reptiles the lungs retain very nearly this primitive sac-like character, but in the higher forms the connection with the esophagus becomes elongated into the windpipe and the inner walls of the sacs become more and more divided, until, in the mammals, the air spaces become minutely divided into tubes ending in small air cells, in the walls of which the blood circulates in a fine network of capillaries. In mammals the lungs are more or less divided into lobes, and each lung occupies a separate cavity in the thorax.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0008202	steroid metabolic process	The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
cellular component
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		A0D	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NAP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3lz6)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3lz6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	DHI1_CAVPO \| Q6QLL4
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.1.1.146
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	DHI1_CAVPO \| Q6QLL4
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	DHI1_CAVPO \| Q6QLL4	:	1xse 3dwf 3g49

(no "Related Entries Specified in the PDB File" available for 3LZ6)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 8)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (0, 0)

Pfam Domains (1, 4)

Gene Ontology (11, 11)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File