Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  PUTATIVE CHORISMATE MUTASE FROM BIFIDOBACTERIUM ADOLESCENTIS
 
Authors :  J. Osipiuk, L. Bigelow, J. Bearden, A. Joachimiak, Midwest Center Fo Structural Genomics (Mcsg)
Date :  18 Feb 10  (Deposition) - 09 Mar 10  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Structural Genomics, Apc38059, Chorismate, Mutase, 3-Phenylpyruvate, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Osipiuk, L. Bigelow, J. Bearden, A. Joachimiak
X-Ray Crystal Structure Of Putative Chorismate Mutase From Bifidobacterium Adolescentis.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PROBABLE CHORISMATE MUTASE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPMCSG19
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneBAD_1067, PHEA
    Organism ScientificBIFIDOBACTERIUM ADOLESCENTIS
    Organism Taxid367928
    StrainATCC 15703

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 7)

Asymmetric Unit (2, 7)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE
2PPY1Ligand/Ion3-PHENYLPYRUVIC ACID
Biological Unit 1 (2, 14)
No.NameCountTypeFull Name
1MSE12Mod. Amino AcidSELENOMETHIONINE
2PPY2Ligand/Ion3-PHENYLPYRUVIC ACID

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:215 , GLY A:217 , VAL A:218 , LEU A:219 , ASN A:232 , MSE A:233 , THR A:234 , SER A:235 , TYR A:248 , PHE A:250 , HOH A:327 , HOH A:403 , HOH A:404BINDING SITE FOR RESIDUE PPY A 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3LUY)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Gly A:10 -Pro A:11

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3LUY)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3LUY)

(-) Exons   (0, 0)

(no "Exon" information available for 3LUY)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:326
 aligned with A1A2B5_BIFAA | A1A2B5 from UniProtKB/TrEMBL  Length:326

    Alignment length:326
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320      
         A1A2B5_BIFAA     1 MSARKLFYLGPQGTFTHQAAVNAAQELARFEPQGFDLMPMDDVPQILDAAQHGDGWGIVAWENNVEGYVVPNLDALIDAKDLVGFARVGVNVEFDAYVAQGADPAEARIATAHPHGLAQCKRFIAEHRLSTQPATSNAAACRDLIPGEIAFGPAICGELYDITRIGTAIQDYQGAATDFLVLSPRAEVARLLAKPRAEANVEYESVLTLIPLVTGPGVLANLLDVFRDAGLNMTSFISRPIKGRTGTYSFIVTLDAAPWEERFRDALVEIAEHGDWAKTLAVYPRREHPNPPVTSWMLPQGGVRLDDSHLPDDWQNDETVRRELMW 326
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----PDT-3luyA01 A:6-187                                                                                                                                                                   ------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee....hhhhhhhhhhhhhhhhhh...eeeeee.hhhhhhhhhhhh..eeeeeeee...eehhhhhhhhhh....eeeeeeeee...eeeee...hhhhh.eeeehhhhhhhhhhhhhhh..eeee..hhhhhhhh....eeeee..hhhhhh.eeeee.........eeeeeeeehhhhhhhhhhhhhhh....eeeeeeee......hhhhhhhhhhhhh...eeeeeeeee..eeeeeeeeeee.....hhhhhhhhhhhhhh..eeeeeeeee.......hhhhh................hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3luy A   1 mSARKLFYLGPQGTFTHQAAVNAAQELARFEPQGFDLmPmDDVPQILDAAQHGDGWGIVAWENNVEGYVVPNLDALIDAKDLVGFARVGVNVEFDAYVAQGADPAEARIATAHPHGLAQCKRFIAEHRLSTQPATSNAAACRDLIPGEIAFGPAICGELYDITRIGTAIQDYQGAATDFLVLSPRAEVARLLAKPRAEANVEYESVLTLIPLVTGPGVLANLLDVFRDAGLNmTSFISRPIKGRTGTYSFIVTLDAAPWEERFRDALVEIAEHGDWAKTLAVYPRREHPNPPVTSWmLPQGGVRLDDSHLPDDWQNDETVRRELmW 326
                            |       10        20        30       |40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230  |    240       250       260       270       280       290      |300       310       320    | 
                            |                                   38-MSE                                                                                                                                                                                            233-MSE                                                         297-MSE                     325-MSE
                            1-MSE                                 40-MSE                                                                                                                                                                                                                                                                                          

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3LUY)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3LUY)

(-) Pfam Domains  (1, 1)

Asymmetric Unit

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A   (A1A2B5_BIFAA | A1A2B5)
molecular function
    GO:0016597    amino acid binding    Interacting selectively and non-covalently with an amino acid, organic acids containing one or more amino substituents.
    GO:0004106    chorismate mutase activity    Catalysis of the reaction: chorismate = prephenate.
    GO:0004664    prephenate dehydratase activity    Catalysis of the reaction: prephenate = phenylpyruvate + H2O + CO2.
biological process
    GO:0009094    L-phenylalanine biosynthetic process    The chemical reactions and pathways resulting in the formation of L-phenylalanine, the L-enantiomer of 2-amino-3-phenylpropanoic acid, i.e. (2S)-2-amino-3-phenylpropanoic acid.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PPY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:10 - Pro A:11   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3luy
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A1A2B5_BIFAA | A1A2B5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A1A2B5_BIFAA | A1A2B5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3LUY)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3LUY)