Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PUTATIVE ISOCHORISMATASE HYDROLASE FROM OLEISPIRA ANTARCTICA
 
Authors :  A. Goral, M. Chruszcz, O. Kagan, M. Cymborowski, A. Savchenko, A. Joach W. Minor, Midwest Center For Structural Genomics (Mcsg)
Date :  10 Feb 10  (Deposition) - 16 Mar 10  (Release) - 25 Dec 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.75
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  A  (2x)
Keywords :  Structural Genomics, Isochorismatase, Hydrolase, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. M. Goral, K. L. Tkaczuk, M. Chruszcz, O. Kagan, A. Savchenko, W. Mino
Crystal Structure Of A Putative Isochorismatase Hydrolase From Oleispira Antarctica.
J. Struct. Funct. Genom. V. 13 27 2012
PubMed-ID: 22350524  |  Reference-DOI: 10.1007/S10969-012-9127-5
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PUTATIVE ISOCHORISMATASE HYDROLASE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidP15TV LIC
    Expression System StrainBL21-CODONPLUS(DE3)-RIPL
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneOLEI00908_1_189
    Organism ScientificOLEISPIRA ANTARCTICA
    Organism Taxid188908

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (1x)A
Biological Unit 2 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 6)

Asymmetric Unit (3, 6)
No.NameCountTypeFull Name
1CSD1Mod. Amino Acid3-SULFINOALANINE
2GOL1Ligand/IonGLYCEROL
3MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (3, 6)
No.NameCountTypeFull Name
1CSD1Mod. Amino Acid3-SULFINOALANINE
2GOL1Ligand/IonGLYCEROL
3MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (3, 12)
No.NameCountTypeFull Name
1CSD2Mod. Amino Acid3-SULFINOALANINE
2GOL2Ligand/IonGLYCEROL
3MSE8Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:30 , ALA A:148 , THR A:149 , ALA A:161 , ALA A:162 , HIS A:165 , HOH A:1107 , HOH A:1155 , HOH A:1206BINDING SITE FOR RESIDUE GOL A 190

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3LQY)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Ala A:120 -Mse A:121

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3LQY)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3LQY)

(-) Exons   (0, 0)

(no "Exon" information available for 3LQY)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:187
 aligned with L7MTK1_OLEAN | L7MTK1 from UniProtKB/TrEMBL  Length:190

    Alignment length:189
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180         
         L7MTK1_OLEAN     1 GMTTENTTALLLIDFQNDYFSTYNGAKNPLVGTEAAAEQGAKLLAKFRQQGLPVVHVRHEFPTDEAPFFLPGSDGAKIHPSVAAQEGEAVVLKHQINSFRDTDLKKVLDDAGIKKLVIVGAMTHMCIDAVTRAAEDLGYECAVAHDACATLDLEFNGITVPAAQVHAAFMSALSFAYANVASADELIAG 189
               SCOP domains d3lqya_ A: automated matches                                                                                                                                                                  SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeee..hhhhh...........hhhhhhhhhhhhhhhhhhh...eeeeee..-..........hhhhh.hhhhh......eeee.........hhhhhhhhh-..eeeeeee...hhhhhhhhhhhhhh.eeeeeeeeee...eee..eeehhhhhhhhhhhhhh....eeehhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3lqy A   0 GmTTENTTALLLIDFQNDYFSTYNGAKNPLVGTEAAAEQGAKLLAKFRQQGLPVVHVRHEF-TDEAPFFLPGSDGAKIHPSVAAQEGEAVVLKHQINSFRDTDLKKVLDDA-IKKLVIVGAmTHmcIDAVTRAAEDLGYECAVAHDACATLDLEFNGITVPAAQVHAAFmSALSFAYANVASADELIAG 188
                             |       9        19        29        39        49        59| |     69        79        89        99       109| |    119 |  || 129       139       149       159       169       179         
                             |                                                         60 |                                             110 |      121-MSE                                         169-MSE               
                             1-MSE                                                       62                                               112         124-MSE                                                            
                                                                                                                                                       125-CSD                                                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3LQY)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3LQY)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A   (L7MTK1_OLEAN | L7MTK1)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CSD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:120 - Mse A:121   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3lqy
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  L7MTK1_OLEAN | L7MTK1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  L7MTK1_OLEAN | L7MTK1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3LQY)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3LQY)