Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF STAGE V SPORULATION PROTEIN AD (SPOVAD) FROM BACILLUS SUBTILIS, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET SR525
 
Authors :  F. Forouhar, M. Su, J. Seetharaman, F. Fang, R. Xiao, K. Cunningham, L. Ma, D. Wang, J. K. Everett, R. Nair, T. B. Acton, B. Rost, G. T. Montelione, L. Tong, J. F. Hunt, Northeast Structural Genomics Consortium (Nesg)
Date :  29 Jan 10  (Deposition) - 16 Feb 10  (Release) - 16 Feb 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Alpha-Beta Protein. , Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Sporulation, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  F. Forouhar, M. Su, J. Seetharaman, F. Fang, R. Xiao, K. Cunningham, L. Ma, D. Wang, J. K. Everett, R. Nair, T. B. Acton, B. Rost, G. T. Montelione, L. Tong, J. F. Hunt
Northeast Structural Genomics Consortium Target Sr525
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - STAGE V SPORULATION PROTEIN AD
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET21
    Expression System StrainBL21(DE3)+ MAGIC
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneBSU23410, SPOVAD
    Organism ScientificBACILLUS SUBTILIS SUBSP. SUBTILIS
    Organism Taxid224308
    Strain168

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 18)

Asymmetric/Biological Unit (1, 18)
No.NameCountTypeFull Name
1MSE18Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3LM6)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3LM6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3LM6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3LM6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3LM6)

(-) Exons   (0, 0)

(no "Exon" information available for 3LM6)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:334
 aligned with SP5AD_BACSU | P40869 from UniProtKB/Swiss-Prot  Length:338

    Alignment length:334
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330    
          SP5AD_BACSU     1 MKLTGKQTWVFEHPIFVNSAGTAAGPKEKDGPLGSLFDKTYDEMHCNQKSWEMAERQLMEDAVNVALQKNNLTKDDIDLLLAGDLLNQNVTANYVARHLKIPFLCMFGACSTSMETVAVASALVDGGFAKRALAATSSHNATAERQFRYPTEYGGQKPDTATSTVTGSGAVVISQTPGDIQITSATVGKVSDLGITDPFDMGSAMAPAAADTIKQHFKDLNRTADDYDLILTGDLSGVGSPIVKDILKEDGYPVGTKHDDCGLLIYTPDQQVFAGGSGCACSAVVTYSHIFKQLREGKLNRVFVVATGALLSPTMIQQKETIPTIAHGVVFERA 334
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee...eeeeeeeeeeeeeeeeehhhhhh..hhhhh.ee.........hhhhhhhhhhhhhhhhhhhhh..hhhhh.eeeeee.hhhhhhhhhhhhhhh..eee..hhhhhhhhhhhhhhhhhhh....eeeeeeee..hhhhhhh..hhhhh........ee..eeeeeeee.....eeeeeee.............hhhhhhhhhhhhhhhhhhhhh..hhhhh.eeee..hhhhhhhhhhhhhhhh...hhh.eeehhhhh..........eehhhhhhhhhhhhhhhhhhh....eeeeeeeee..hhhhhh......eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3lm6 A   1 mKLTGKQTWVFEHPIFVNSAGTAAGPKEKDGPLGSLFDKTYDEmHCNQKSWEmAERQLmEDAVNVALQKNNLTKDDIDLLLAGDLLNQNVTANYVARHLKIPFLCmFGACSTSmETVAVASALVDGGFAKRALAATSSHNATAERQFRYPTEYGGQKPDTATSTVTGSGAVVISQTPGDIQITSATVGKVSDLGITDPFDmGSAmAPAAADTIKQHFKDLNRTADDYDLILTGDLSGVGSPIVKDILKEDGYPVGTKHDDCGLLIYTPDQQVFAGGSGCACSAVVTYSHIFKQLREGKLNRVFVVATGALLSPTmIQQKETIPTIAHGVVFERA 334
                            |       10        20        30        40   |    50  |     60        70        80        90       100     | 110   |   120       130       140       150       160       170       180       190       200|   |  210       220       230       240       250       260       270       280       290       300       310    |  320       330    
                            |                                         44-MSE   53-MSE |                                            106-MSE 114-MSE                                                                                201-MSE                                                                                                           315-MSE               
                            1-MSE                                                    59-MSE                                                                                                                                           205-MSE                                                                                                                             

Chain B from PDB  Type:PROTEIN  Length:322
 aligned with SP5AD_BACSU | P40869 from UniProtKB/Swiss-Prot  Length:338

    Alignment length:334
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330    
          SP5AD_BACSU     1 MKLTGKQTWVFEHPIFVNSAGTAAGPKEKDGPLGSLFDKTYDEMHCNQKSWEMAERQLMEDAVNVALQKNNLTKDDIDLLLAGDLLNQNVTANYVARHLKIPFLCMFGACSTSMETVAVASALVDGGFAKRALAATSSHNATAERQFRYPTEYGGQKPDTATSTVTGSGAVVISQTPGDIQITSATVGKVSDLGITDPFDMGSAMAPAAADTIKQHFKDLNRTADDYDLILTGDLSGVGSPIVKDILKEDGYPVGTKHDDCGLLIYTPDQQVFAGGSGCACSAVVTYSHIFKQLREGKLNRVFVVATGALLSPTMIQQKETIPTIAHGVVFERA 334
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ----SpoVAD-3lm6B01 B:5-332                                                                                                                                                                                                                                                                                                                  -- Pfam domains (1)
           Pfam domains (2) ----SpoVAD-3lm6B02 B:5-332                                                                                                                                                                                                                                                                                                                  -- Pfam domains (2)
         Sec.struct. author ..ee...eeeeeeeeeeeeeeeeehhhhhh..hhhhh.ee.........hhhhhhhhhhhhhhhhhhhhh..hhhhh.eeeeee.hhhhhhhhhhhhhhh..eee..hhhhhhhhhhhhhhhhhhh....eeeeeeeehhhhhhh------------.....ee..eeeeeeee.....eeeeeee.............hhhhhhhhhhhhhhhhhhhhh..hhhhh.eeee..hhhhhhhhhhhhhhhh...hhh.eeehhhhh..........eehhhhhhhhhhhhhhhhhhh....eeeeeeeee..hhhhhh......eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3lm6 B   1 mKLTGKQTWVFEHPIFVNSAGTAAGPKEKDGPLGSLFDKTYDEmHCNQKSWEmAERQLmEDAVNVALQKNNLTKDDIDLLLAGDLLNQNVTANYVARHLKIPFLCmFGACSTSmETVAVASALVDGGFAKRALAATSSHNATAER------------PDTATSTVTGSGAVVISQTPGDIQITSATVGKVSDLGITDPFDmGSAmAPAAADTIKQHFKDLNRTADDYDLILTGDLSGVGSPIVKDILKEDGYPVGTKHDDCGLLIYTPDQQVFAGGSGCACSAVVTYSHIFKQLREGKLNRVFVVATGALLSPTmIQQKETIPTIAHGVVFERA 334
                            |       10        20        30        40   |    50  |     60        70        80        90       100     | 110   |   120       130       140    |    -       160       170       180       190       200|   |  210       220       230       240       250       260       270       280       290       300       310    |  320       330    
                            1-MSE                                     44-MSE   53-MSE |                                            106-MSE 114-MSE                        145          158                                        201-MSE                                                                                                           315-MSE               
                                                                                     59-MSE                                                                                                                                           205-MSE                                                                                                                             

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3LM6)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3LM6)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: Thiolase (72)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (SP5AD_BACSU | P40869)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0030435    sporulation resulting in formation of a cellular spore    The process in which a relatively unspecialized cell acquires the specialized features of a cellular spore, a cell form that can be used for dissemination, for survival of adverse conditions because of its heat and dessication resistance, and/or for reproduction.
cellular component
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0031160    spore wall    The specialized envelope lying outside the cell membrane of a spore.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3lm6)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3lm6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3lm6
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SP5AD_BACSU | P40869
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SP5AD_BACSU | P40869
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3LM6)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3LM6)