3LLQ - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Title :   AQUAPORIN STRUCTURE FROM PLANT PATHOGEN AGROBACTERIUM TUMERFACIENS

Authors :   Q. Liu, B. Hillerich, J. Love, New York Consortium On Membrane Pro Structure (Nycomps)

Date :   29 Jan 10 (Deposition) - 16 Feb 10 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.01

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (2x)

Keywords :   Aquaporin Tetramer, Membrane Protein, Water Channel, Structural Genomics, Psi-2, Protein Structure Initiative, New York Consortium On Membrane Protein Structure, Nycomps (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Q. Liu, B. Hillerich, J. Love, Nycomps
Aquaporin Structure From Plant Pathogen Agrobacterium Tumerfaciens
To Be Published
PubMed: search

Molecule 1 - AQUAPORIN Z 2
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PNYCOMPS-LIC-FH10T+(N TERM)
	Expression System Strain	:	BL21 PLYSS
	Expression System Taxid	:	511693
	Expression System Vector Type	:	PLASMID
	Gene	:	AGR_PAT_521, AQPZ2, ATU5361
	Organism Scientific	:	AGROBACTERIUM TUMEFACIENS STR.
	Organism Taxid	:	176299
	Strain	:	C58

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (2x)	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 3LLQ)

(no "Site" information available for 3LLQ)

(no "SS Bond" information available for 3LLQ)

(no "Cis Peptide Bond" information available for 3LLQ)

(no "SAP(SNP)/Variant" information available for 3LLQ)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	MIP	PS00221	MIP family signature.	AQPZ2_AGRFC	61-69	2	A:61-69 B:61-69

Biological Unit 1 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	MIP	PS00221	MIP family signature.	AQPZ2_AGRFC	61-69	4	A:61-69 B:61-69

(no "Exon" information available for 3LLQ)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:228
 aligned with AQPZ2_AGRFC | Q8UJW4 from UniProtKB/Swiss-Prot  Length:228

    Alignment length:228
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220        
          AQPZ2_AGRFC     1 MGRKLLAEFFGTFWLVFGGCGSAVFAAAFPELGIGFTGVALAFGLTVLTMAYAVGGISGGHFNPAVSVGLTVAGRFPASSLVPYVIAQVAGAIVAAAALYVIATGKAGIDLGGFASNGYGEHSPGGYSLVSALLIEIILTAFFLIVILGSTHGRVPAGFAPIAIGLALTLIHLISIPVTNTSVNPARSTGQALFVGGWALQQLWLFWLAPIVGGAAGAVIWKLFGEKD 228
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 3llqA00 A:1-228 Glycerol uptake facilitator protein.                                                                                                                                                                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------MIP      --------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3llq A   1 MGRKLLAEFFGTFWLVFGGCGSAVFAAAFPELGIGFTGVALAFGLTVLTMAYAVGGISGGHFNPAVSVGLTVAGRFPASSLVPYVIAQVAGAIVAAAALYVIATGKAGIDLGGFASNGYGEHSPGGYSLVSALLIEIILTAFFLIVILGSTHGRVPAGFAPIAIGLALTLIHLISIPVTNTSVNPARSTGQALFVGGWALQQLWLFWLAPIVGGAAGAVIWKLFGEKD 228
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220

Chain B from PDB  Type:PROTEIN  Length:233
 aligned with AQPZ2_AGRFC | Q8UJW4 from UniProtKB/Swiss-Prot  Length:228

    Alignment length:233
                                  1                                                                                                                                                                                                                                  
                                  |  4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224   
          AQPZ2_AGRFC     - ------MGRKLLAEFFGTFWLVFGGCGSAVFAAAFPELGIGFTGVALAFGLTVLTMAYAVGGISGGHFNPAVSVGLTVAGRFPASSLVPYVIAQVAGAIVAAAALYVIATGKAGIDLGGFASNGYGEHSPGGYSLVSALLIEIILTAFFLIVILGSTHGRVPAGFAPIAIGLALTLIHLISIPVTNTSVNPARSTGQALFVGGWALQQLWLFWLAPIVGGAAGAVIWKLFGEK 227
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3llqB00 B:-5-227 Glycerol uptake facilitator protein.                                                                                                                                                                                     CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------MIP      -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3llq B  -5 YFQSYVMGRKLLAEFFGTFWLVFGGCGSAVFAAAFPELGIGFTGVALAFGLTVLTMAYAVGGISGGHFNPAVSVGLTVAGRFPASSLVPYVIAQVAGAIVAAAALYVIATGKAGIDLGGFASNGYGEHSPGGYSLVSALLIEIILTAFFLIVILGSTHGRVPAGFAPIAIGLALTLIHLISIPVTNTSVNPARSTGQALFVGGWALQQLWLFWLAPIVGGAAGAVIWKLFGEK 227
                                     4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3LLQ)

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Glycerol uptake facilitator protein (37)

Homologous Superfamily: Glycerol uptake facilitator protein. (37)

C58 (Agrobacterium tumefaciens str) (1)

1a	3llqB00	B:-5-227
1b	3llqA00	A:1-228

(no "Pfam Domain" information available for 3LLQ)

Asymmetric Unit(hide GO term definitions)

Chain A,B (AQPZ2_AGRFC | Q8UJW4)

molecular function
	GO:0005215	transporter activity	Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
	GO:0015250	water channel activity	Transport systems of this type enable facilitated diffusion of water (by an energy-independent process) by passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism.
biological process
	GO:0055085	transmembrane transport	The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0006833	water transport	The directed movement of water (H2O) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3llq)

	Sites
(no "Sites" information available for 3llq)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3llq)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3llq
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AQPZ2_AGRFC \| Q8UJW4
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	AQPZ2_AGRFC \| Q8UJW4
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 3LLQ)

(no "Related Entries Specified in the PDB File" available for 3LLQ)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File