|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 9)| Asymmetric/Biological Unit (3, 9) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3LHE) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3LHE) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3LHE) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3LHE) |
Exons (0, 0)| (no "Exon" information available for 3LHE) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:124 aligned with Q81MW2_BACAN | Q81MW2 from UniProtKB/TrEMBL Length:245 Alignment length:139 102 112 122 132 142 152 162 172 182 192 202 212 222 Q81MW2_BACAN 93 VYGSEVESKIIEFTIVGADEIIAEKLGISVGDFVYKIIRLRIIHSIPTIMEHTWMPISVIPGVEVSVLEESIYSHIQNKLGLQVGTSVVRVKGIRPDDKEKQFMNLTNQDFLMRVEQVAYLTDGRTFEYSYADHLPETF 231 SCOP domains d3lhea_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains UTRA-3lheA01 A:93-231 Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3lhe A 93 VYGSEVESKIIEFTIVGADEIIAEKLGISVGDFVYKIIRLRIIHSIPTImEHTWmPISVIPGVE---------------LGLQVGTSVVRVKGIRPDDKEKQFmNLTNQDFLmRVEQVAYLTDGRTFEYSYADHLPETF 231 102 112 122 132 142 | 152 | - 172 182 192 | 202 | 212 222 142-MSE| 156 172 196-MSE 205-MSE 147-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3LHE) |
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q81MW2_BACAN | Q81MW2)
|
||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|