3LG6 - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF PUTATIVE GLUTATHIONE TRANSFERASE FROM COCCIDIOIDES IMMITIS

Authors :   Seattle Structural Genomics Center For Infectious Disease (S

Date :   19 Jan 10 (Deposition) - 26 Jan 10 (Release) - 21 Sep 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Niaid, Seattle Structural Genomics Center For Infectious Disease, Ssgcid, Als Collaborative Crystallography, Pathogenic Fungus, Coccidioidomycosis, Valley Fever, Meningitis, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. E. Edwards, C. M. Bryan, D. J. Leibly, S. H. Dieterich, J. Abendroth, B. Sankaran, D. Sivam, B. L. Staker, W. C. Van Voorhis, P. J. Myler, L. J. Stewart
Structures Of A Putative Zeta-Class Glutathione S-Transferase From The Pathogenic Fungus Coccidioides Immitis.
Acta Crystallogr. , Sect. F V. 67 1038 2011
PubMed-ID: 21904047 | Reference-DOI: 10.1107/S1744309111009493

Molecule 1 - PUTATIVE GLUTATHIONE TRANSFERASE
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Expression System Vector Type	:	AVA0421
	Organism Scientific	:	COCCIDIOIDES IMMITIS
	Organism Taxid	:	5501

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 4)

No.	Name	Count	Type	Full Name
1	SO4	4	Ligand/Ion	SULFATE ION

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	SO4	2	Ligand/Ion	SULFATE ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ARG A:13 , SER A:15 , GLN A:124 , ASN A:128 , HOH A:259 , HOH A:267 , HOH A:290 , HOH A:316	BINDING SITE FOR RESIDUE SO4 A 232
2	AC2	SOFTWARE	ARG B:13 , SER B:14 , SER B:15 , GLN B:124 , ASN B:128 , HOH B:264 , HOH B:273 , HOH B:274 , HOH B:284 , HOH B:568	BINDING SITE FOR RESIDUE SO4 B 232
3	AC3	SOFTWARE	ARG C:13 , SER C:14 , SER C:15 , GLN C:124 , ASN C:128 , HOH C:263 , HOH C:275 , HOH C:280	BINDING SITE FOR RESIDUE SO4 C 232
4	AC4	SOFTWARE	SER D:14 , SER D:15 , GLN D:124 , ASN D:128 , HOH D:235 , HOH D:260	BINDING SITE FOR RESIDUE SO4 D 232

(no "SS Bond" information available for 3LG6)

Asymmetric Unit

No.	Residues
1	Asn A:52	-	Pro A:53
2	Val A:57	-	Pro A:58
3	Val B:57	-	Pro B:58
4	Val C:57	-	Pro C:58
5	Val D:57	-	Pro D:58

(no "SAP(SNP)/Variant" information available for 3LG6)

Asymmetric Unit (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	GST_COCIM	4-96	4	A:4-96 B:4-96 C:4-96 D:4-96
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GST_COCIM	105-227	4	A:105-227 B:105-227 C:105-227 D:105-227

Biological Unit 1 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	GST_COCIM	4-96	2	A:4-96 B:4-96 - -
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GST_COCIM	105-227	2	A:105-227 B:105-227 - -

Biological Unit 2 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	GST_COCIM	4-96	2	- - C:4-96 D:4-96
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GST_COCIM	105-227	2	- - C:105-227 D:105-227

(no "Exon" information available for 3LG6)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:229
 aligned with GST_COCIM | D2YW48 from UniProtKB/Swiss-Prot  Length:231

    Alignment length:229
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222         
            GST_COCIM     3 TPNFELYGYFRSSCSGRLRIAFHLKSIPYTRHPVNLLKGEQHSDTYKSLNPTNTVPLLVVSNINNTVSPSSASFSIGQSLAALEYLEEALPTNARPLLPPISNPVARAHVRTICNIIACDVQPVTNLKIQKKVKALDGDPTVWSRDLATQGFGAVEKLLELSAGRFCVGDEITLADVCLVPAVWAAERVGMDLARFPITKRVFEEMLKEEAVQKAHWQKQEDTPEDLRA 231
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------3lg6A02 A:101-231  [code=1.20.1050.10, no name defined]                                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee...hhhhhhhhhhhhhh....eeee.....hhhhhhhhh.........eeee.............eee.hhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -GST_NTER  PDB: A:4-96 UniProt: 4-96                                                          --------GST_CTER  PDB: A:105-227 UniProt: 105-227                                                                                  ---- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3lg6 A   3 TPNFELYGYFRSSCSGRLRIAFHLKSIPYTRHPVNLLKGEQHSDTYKSLNPTNTVPLLVVSNINNTVSPSSASFSIGQSLAALEYLEEALPTNARPLLPPISNPVARAHVRTICNIIACDVQPVTNLKIQKKVKALDGDPTVWSRDLATQGFGAVEKLLELSAGRFCVGDEITLADVCLVPAVWAAERVGMDLARFPITKRVFEEMLKEEAVQKAHWQKQEDTPEDLRA 231
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222

Chain B from PDB  Type:PROTEIN  Length:217
 aligned with GST_COCIM | D2YW48 from UniProtKB/Swiss-Prot  Length:231

    Alignment length:232
                             1                                                                                                                                                                                                                                      
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229  
            GST_COCIM     - -MTTPNFELYGYFRSSCSGRLRIAFHLKSIPYTRHPVNLLKGEQHSDTYKSLNPTNTVPLLVVSNINNTVSPSSASFSIGQSLAALEYLEEALPTNARPLLPPISNPVARAHVRTICNIIACDVQPVTNLKIQKKVKALDGDPTVWSRDLATQGFGAVEKLLELSAGRFCVGDEITLADVCLVPAVWAAERVGMDLARFPITKRVFEEMLKEEAVQKAHWQKQEDTPEDLRA 231
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -----------------------------------------------------------------------------------------------------3lg6B02 B:101-231  [code=1.20.1050.10, no name defined]                                                                             CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeee...hhhhhhhhhhhhhh....eeee....---------------....eeeee...........eeee.hhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.hhhhhhh........hhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----GST_NTER  PDB: B:4-96 UniProt: 4-96                                                          --------GST_CTER  PDB: B:105-227 UniProt: 105-227                                                                                  ---- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3lg6 B   0 SMTTPNFELYGYFRSSCSGRLRIAFHLKSIPYTRHPVNLL---------------NTVPLLVVSNINNTVSPSSASFSIGQSLAALEYLEEALPTNARPLLPPISNPVARAHVRTICNIIACDVQPVTNLKIQKKVKALDGDPTVWSRDLATQGFGAVEKLLELSAGRFCVGDEITLADVCLVPAVWAAERVGMDLARFPITKRVFEEMLKEEAVQKAHWQKQEDTPEDLRA 231
                                     9        19        29        39         -     |  59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229  
                                                                  39              55

Chain C from PDB  Type:PROTEIN  Length:228
 aligned with GST_COCIM | D2YW48 from UniProtKB/Swiss-Prot  Length:231

    Alignment length:230
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231
            GST_COCIM     2 TTPNFELYGYFRSSCSGRLRIAFHLKSIPYTRHPVNLLKGEQHSDTYKSLNPTNTVPLLVVSNINNTVSPSSASFSIGQSLAALEYLEEALPTNARPLLPPISNPVARAHVRTICNIIACDVQPVTNLKIQKKVKALDGDPTVWSRDLATQGFGAVEKLLELSAGRFCVGDEITLADVCLVPAVWAAERVGMDLARFPITKRVFEEMLKEEAVQKAHWQKQEDTPEDLRA 231
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------3lg6C02 C:101-231  [code=1.20.1050.10, no name defined]                                                                             CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeee...hhhhhhhhhhhhhh....eeee.hhhhhhhhhhhhhhhh--....eeeee...........eeee.hhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.hhhhhhhhhhhh...hhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --GST_NTER  PDB: C:4-96 UniProt: 4-96                                                          --------GST_CTER  PDB: C:105-227 UniProt: 105-227                                                                                  ---- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3lg6 C   2 TTPNFELYGYFRSSCSGRLRIAFHLKSIPYTRHPVNLLKGEQHSDTYKSLN--NTVPLLVVSNINNTVSPSSASFSIGQSLAALEYLEEALPTNARPLLPPISNPVARAHVRTICNIIACDVQPVTNLKIQKKVKALDGDPTVWSRDLATQGFGAVEKLLELSAGRFCVGDEITLADVCLVPAVWAAERVGMDLARFPITKRVFEEMLKEEAVQKAHWQKQEDTPEDLRA 231
                                    11        21        31        41        51|  |    61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231
                                                                             52 55

Chain D from PDB  Type:PROTEIN  Length:219
 aligned with GST_COCIM | D2YW48 from UniProtKB/Swiss-Prot  Length:231

    Alignment length:231
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230 
            GST_COCIM     1 MTTPNFELYGYFRSSCSGRLRIAFHLKSIPYTRHPVNLLKGEQHSDTYKSLNPTNTVPLLVVSNINNTVSPSSASFSIGQSLAALEYLEEALPTNARPLLPPISNPVARAHVRTICNIIACDVQPVTNLKIQKKVKALDGDPTVWSRDLATQGFGAVEKLLELSAGRFCVGDEITLADVCLVPAVWAAERVGMDLARFPITKRVFEEMLKEEAVQKAHWQKQEDTPEDLRA 231
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------3lg6D02 D:101-231  [code=1.20.1050.10, no name defined]                                                                             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee...hhhhhhhhhhhhhh....eeee.......------------....eeeee............eee.hhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---GST_NTER  PDB: D:4-96 UniProt: 4-96                                                          --------GST_CTER  PDB: D:105-227 UniProt: 105-227                                                                                  ---- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3lg6 D   1 MTTPNFELYGYFRSSCSGRLRIAFHLKSIPYTRHPVNLLKGE------------NTVPLLVVSNINNTVSPSSASFSIGQSLAALEYLEEALPTNARPLLPPISNPVARAHVRTICNIIACDVQPVTNLKIQKKVKALDGDPTVWSRDLATQGFGAVEKLLELSAGRFCVGDEITLADVCLVPAVWAAERVGMDLARFPITKRVFEEMLKEEAVQKAHWQKQEDTPEDLRA 231
                                    10        20        30        40 |       -    |   60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230 
                                                                    42           55

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3LG6)

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 (267)

Homologous Superfamily: [code=1.20.1050.10, no name defined] (249)

Coccidioides immitis. Organism_taxid: 5501. (1)

1a	3lg6A02	A:101-231
1b	3lg6B02	B:101-231
1c	3lg6C02	C:101-231
1d	3lg6D02	D:101-231

(no "Pfam Domain" information available for 3LG6)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (GST_COCIM | D2YW48)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0004364	glutathione transferase activity	Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0009072	aromatic amino acid family metabolic process	The chemical reactions and pathways involving aromatic amino acid family, amino acids with aromatic ring (phenylalanine, tyrosine, tryptophan).
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Asn A:52 - Pro A:53	[ RasMol ]
		Val A:57 - Pro A:58	[ RasMol ]
		Val B:57 - Pro B:58	[ RasMol ]
		Val C:57 - Pro C:58	[ RasMol ]
		Val D:57 - Pro D:58	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3lg6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GST_COCIM \| D2YW48
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GST_COCIM \| D2YW48
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GST_COCIM \| D2YW48	:	3n5o

(no "Related Entries Specified in the PDB File" available for 3LG6)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (5, 5)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 8)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (5, 5)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File