|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 6)| Asymmetric Unit (2, 6) Biological Unit 1 (2, 12) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3LDT) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3LDT) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3LDT) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3LDT) |
Exons (0, 0)| (no "Exon" information available for 3LDT) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:144 aligned with Q5ZXS4_LEGPH | Q5ZXS4 from UniProtKB/TrEMBL Length:249 Alignment length:147 101 111 121 131 141 151 161 171 181 191 201 211 221 231 Q5ZXS4_LEGPH 92 GLVASIYRDSKRKIIRDLQKQDIQYVEYGDTRTLIIPTDKYFMFSSPRLNEICYPGLNNVIRLLNFYPQSTIYVAGFTDNVGSRSHKRKLSQAQAETMMTFLWANGIAAKRLKAEGYGDKNAISDNAIIHGSAQNRRIEIQWFTSPA 238 SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------Omp A-3ldtA01 A:132-228 ---------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3ldt A 92 GLVASIYRDSKRKIIRDLQKQDIQYVEYGDTRTLIIPTDKYFm-SSPRLNEICYPGLNNVIRLLNFYPQSTIYVAGFTDNVGSR--KRKLSQAQAETmmTFLWANGIAAKRLKAEGYGDKNAISDNAIIHGSAQNRRIEIQWFTSEG 238 101 111 121 131 | | 141 151 161 171 | |181 191 201 211 221 231 134-MSE 175 | 189-MSE 136 178 190-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3LDT) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3LDT) |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A (Q5ZXS4_LEGPH | Q5ZXS4)
|
||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|