Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF SMU.1046C FROM STREPTOCOCCUS MUTANS UA159
 
Authors :  X. -D. Su, Y. H. Huang, X. Liu
Date :  05 Jan 10  (Deposition) - 12 Jan 11  (Release) - 12 Jan 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.48
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Gtp Pyrophosphokinase, Kinase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  X. -D. Su, Y. H. Huang, X. Liu
The Crystal Structure Of Smu. 1046C From Streptococcus Mutan Ua159
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE GTP PYROPHOSPHOKINASE
    ChainsA, B
    EC Number2.7.6.5
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28A
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneSMU.1046C
    Organism ScientificSTREPTOCOCCUS MUTANS
    Organism Taxid210007
    StrainUA159
    SynonymSMU.1046C

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3L9D)

(-) Sites  (0, 0)

(no "Site" information available for 3L9D)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3L9D)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3L9D)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3L9D)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3L9D)

(-) Exons   (0, 0)

(no "Exon" information available for 3L9D)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:198
 aligned with Q8DU97_STRMU | Q8DU97 from UniProtKB/TrEMBL  Length:221

    Alignment length:199
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190         
         Q8DU97_STRMU     1 MNWEEFLDPYIQAVGELKIKFRGIRKQFRKQKRHSPIEFVTGRVKPIESIKEKMVLRGIKKENLTQDMQDIAGLRIMVQFVDDVNDVLELLRQRKDMKVIQERDYINNLKPSGYRSYHVIVEYPVDTISGQRIIMAEIQIRTLAMNFWATIEHSLNYKYHGEFPEDIKRRLELTSKIAFQLDEEMRQIRDDIKEAQLLF 199
               SCOP domains d3l9da_ A: automated matches                                                                                                                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeee.hhhhhhhhhhhhh.hhhhhhhhh...eeeeeee...hhhhhhhhhhhh....eeeeeeee...-......eeeeeeeeeeee..eeeeeeeeeeeeehhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3l9d A   1 MNWEEFLDPYIQAVGELKIKFRGIRKQFRKQKRHSPIEFVTGRVKPIESIKEKMVLRGIKKENLTQDMQDIAGLRIMVQFVDDVNDVLELLRQRKDMKVIQERDYINN-KPSGYRSYHVIVEYPVDTISGQRIIMAEIQIRTLAMNFWATIEHSLNYKYHGEFPEDIKRRLELTSKIAFQLDEEMRQIRDDIKEAQLLF 199
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190         
                                                                                                                                     108 |                                                                                         
                                                                                                                                       110                                                                                         

Chain B from PDB  Type:PROTEIN  Length:193
 aligned with Q8DU97_STRMU | Q8DU97 from UniProtKB/TrEMBL  Length:221

    Alignment length:196
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193      
         Q8DU97_STRMU     4 EEFLDPYIQAVGELKIKFRGIRKQFRKQKRHSPIEFVTGRVKPIESIKEKMVLRGIKKENLTQDMQDIAGLRIMVQFVDDVNDVLELLRQRKDMKVIQERDYINNLKPSGYRSYHVIVEYPVDTISGQRIIMAEIQIRTLAMNFWATIEHSLNYKYHGEFPEDIKRRLELTSKIAFQLDEEMRQIRDDIKEAQLLF 199
               SCOP domains d3l9db_ B: automated matches                                                                                                                                                                         SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --------------------------------------RelA_SpoT-3l9dB01 B:42-162                                                                                               ------------------------------------- Pfam domains (1)
           Pfam domains (2) --------------------------------------RelA_SpoT-3l9dB02 B:42-162                                                                                               ------------------------------------- Pfam domains (2)
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeee.hhhhhhhhhhhh..............eeeeeee...hhhhhhhhhhhh....eeeeeeee...---....eeeeeeeeeeee..eeeeeeeeeeeeehhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3l9d B   4 EEFLDPYIQAVGELKIKFRGIRKQFRKQKRHSPIEFVTGRVKPIESIKEKMVLRGIKKENLTQDMQDIAGLRIMVQFVDDVNDVLELLRQRKDMKVIQERDYINN---SGYRSYHVIVEYPVDTISGQRIIMAEIQIRTLAMNFWATIEHSLNYKYHGEFPEDIKRRLELTSKIAFQLDEEMRQIRDDIKEAQLLF 199
                                    13        23        33        43        53        63        73        83        93       103    |  113       123       133       143       153       163       173       183       193      
                                                                                                                                  108 112                                                                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3L9D)

(-) Pfam Domains  (1, 2)

Asymmetric Unit

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q8DU97_STRMU | Q8DU97)
molecular function
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
biological process
    GO:0015969    guanosine tetraphosphate metabolic process    The chemical reactions and pathways involving guanine tetraphosphate (5'-ppGpp-3'), a derivative of guanine riboside with four phosphates.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3l9d)
 
  Sites
(no "Sites" information available for 3l9d)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3l9d)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3l9d
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8DU97_STRMU | Q8DU97
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.7.6.5
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8DU97_STRMU | Q8DU97
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3L9D)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3L9D)