Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF SMU.777 FROM STREPTOCOCCUS MUTANS UA159
 
Authors :  X. -D. Su, Y. H. Huang, X. Liu
Date :  05 Jan 10  (Deposition) - 05 Jan 11  (Release) - 05 Jan 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Arod, Amino-Acid Biosynthesis, Aromatic Amino Acid Biosynthesis, Schiff Base, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  X. -D. Su, Y. H. Huang, X. Liu
The Crystal Structure Of Smu. 777 From Streptococcus Mutans Ua159
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - 3-DEHYDROQUINATE DEHYDRATASE
    Chains: A, B
    EC Number: 4.2.1.10
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28A
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: SMU.777
    Organism Scientific: STREPTOCOCCUS MUTANS
    Organism Taxid: 210007
    Strain: UA159
    Synonym: SMU.777, 3-DEHYDROQUINASE, TYPE I DHQASE

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3L9C)

(-) Sites  (0, 0)

(no "Site" information available for 3L9C)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3L9C)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3L9C)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3L9C)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3L9C)

(-) Exons   (0, 0)

(no "Exon" information available for 3L9C)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:226
 aligned with AROD_STRMU | Q8DUW4 from UniProtKB/Swiss-Prot  Length:225

    Alignment length:233
                                    1                                                                                                                                                                                                                                
                                    |2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222   
           AROD_STRMU     - --------MKIVVPVMPQNIEEANQLDLTRIDSTDIIEWRADYLVKDDILTVAPAIFEKFSGHEVIFTLRTEKEGGNISLSNEDYLAIIRDIAALYQPDYIDFEYFSYRDVLEEMYDFSNLILSYHNFEETPENLMEVFSELTALAPRVVKIAVMPKNEQDVLDLMNYTRGFKTLNPNQEYVTMSMSKLGRISRLAADLIGSSWTFASLEQESAPGQISLADMRKIKEVLDAN 225
               SCOP domains -------d3l9ca1 A:0-225 automated matches                                                                                                                                                                                                  SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeee...hhhhhhhh.........eeeee.hhhhhhhhhhhhhhhhhhh...eeeee..hhhhh.....hhhhhhhhhhhhhhhhh..eeeeehhhhhhhhhhhh....eeeeeee......hhhhhhhhhhhh...eeeeee...hhhhhhhhhhhhhhhhhhh...eeeeee.hhhhhhhhhhhhhhh..eee...-------..hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3l9c A -23 SSGLVPRSMKIVVPVMPQNIEEANQLDLTRIDSTDIIEWRADYLVKDDILTVAPAIFEKFSGHEVIFTLRTEKEGGNISLSNEDYLAIIRDIAALYQPDYIDFEYFSYRDVLEEMYDFSNLILSYHNFEETPENLMEVFSELTALAPRVVKIAVMPKNEQDVLDLMNYTRGFKTLNPNQEYVTMSMSKLGRISRLAADLIGSSWTFASL-------QISLADMRKIKEVLDAN 225
                                  || 2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192        |-      |212       222   
                                -17|                                                                                                                                                                                                      201     209                
                                   0                                                                                                                                                                                                                                 


Chain B from PDB  Type:PROTEIN  Length:221
 aligned with AROD_STRMU | Q8DUW4 from UniProtKB/Swiss-Prot  Length:225

    Alignment length:223
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220   
           AROD_STRMU     1 MKIVVPVMPQNIEEANQLDLTRIDSTDIIEWRADYLVKDDILTVAPAIFEKFSGHEVIFTLRTEKEGGNISLSNEDYLAIIRDIAALYQPDYIDFEYFSYRDVLEEMYDFSNLILSYHNFEETPENLMEVFSELTALAPRVVKIAVMPKNEQDVLDLMNYTRGFKTLNPNQEYVTMSMSKLGRISRLAADLIGSSWTFASLEQESAPGQISLADMRKIKEVLD 223
               SCOP domains d3l9cb_ B: automated matches                                                                                                                                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---DHquinase_I-3l9cB01 B:4-220                                                                                                                                                                                              --- Pfam domains (1)
           Pfam domains (2) ---DHquinase_I-3l9cB02 B:4-220                                                                                                                                                                                              --- Pfam domains (2)
         Sec.struct. author .eeeeee...hhhhhhhh.........eeeee.hhhhhhhhhhhhhhhhhhhh..eeeee..hhhhh.....hhhhhhhhhhhhhhhhh..eeeeehhhhhhhhhhhh....eeeeeee......hhhhhhhhhhhh...eeeeee...hhhhhhhhhhhhhhhhhhh....eeeee.hhhhhhhhhhhhhhh..eee.....--.....hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3l9c B   1 MKIVVPVMPQNIEEANQLDLTRIDSTDIIEWRADYLVKDDILTVAPAIFEKFSGHEVIFTLRTEKEGGNISLSNEDYLAIIRDIAALYQPDYIDFEYFSYRDVLEEMYDFSNLILSYHNFEETPENLMEVFSELTALAPRVVKIAVMPKNEQDVLDLMNYTRGFKTLNPNQEYVTMSMSKLGRISRLAADLIGSSWTFASLEQ--APGQISLADMRKIKEVLD 223
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200  |  | 210       220   
                                                                                                                                                                                                                                    203  |                 
                                                                                                                                                                                                                                       206
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3L9C)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: TIM_barrel (694)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (AROD_STRMU | Q8DUW4)
molecular function
    GO:0003855    3-dehydroquinate dehydratase activity    Catalysis of the reaction: 3-dehydroquinate = 3-dehydroshikimate + H(2)O.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
biological process
    GO:0009073    aromatic amino acid family biosynthetic process    The chemical reactions and pathways resulting in the formation of aromatic amino acid family, amino acids with aromatic ring (phenylalanine, tyrosine, tryptophan).
    GO:0008652    cellular amino acid biosynthetic process    The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
    GO:0009423    chorismate biosynthetic process    The chemical reactions and pathways resulting in the formation of the unsymmetrical ether derived from phosphoenolpyruvate and 5-phosphoshikimic acid formed as an intermediate in the biosynthesis of aromatic amino acids and many other compounds.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3l9c)
 
  Sites
(no "Sites" information available for 3l9c)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3l9c)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3l9c
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AROD_STRMU | Q8DUW4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.2.1.10
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  AROD_STRMU | Q8DUW4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3L9C)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3L9C)