3L92 - JenaLib

Title :   PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE FROM YERSINIA PESTIS COMPLEXED WITH COENZYME A.

Authors :   J. Osipiuk, N. Maltseva, M. Makowska-Grzyska, K. Kwon, W. F. Anderson, A. Joachimiak, Center For Structural Genomics Of Infectious D (Csgid)

Date :   04 Jan 10 (Deposition) - 19 Jan 10 (Release) - 01 Oct 14 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.89

Chains :   Asym. Unit : A
Biol. Unit 1: A  (6x)
Biol. Unit 2: A  (3x)
Biol. Unit 3: A  (2x)

Keywords :   Structural Genomics, Phosphopantetheine Adenylyltransferase, Coenzyme A, Atp-Binding, Coenzyme A Biosynthesis, Nucleotide-Binding, Nucleotidyltransferase, Transferase, Center For Structural Genomics Of Infectious Diseases, Csgid (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Osipiuk, N. Maltseva, M. Makowska-Grzyska, K. Kwon, W. F. Anderson A. Joachimiak
X-Ray Crystal Structure Of Phosphopantetheine Adenylyltransferase From Yersinia Pestis.
To Be Published
PubMed: search

Compounds

Molecule 1 - PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE
	Chains	:	A
	EC Number	:	2.7.7.3
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PMCSG7
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	COAD, KDTB, Y0088, YPO0053, YP_0054
	Organism Scientific	:	YERSINIA PESTIS
	Organism Taxid	:	214092
	Strain	:	CO92
	Synonym	:	PANTETHEINE-PHOSPHATE ADENYLYLTRANSFERASE, PPAT, DEPHOSPHO- COA PYROPHOSPHORYLASE

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:9 , THR A:10 , PHE A:11 , HIS A:18 , ALA A:37 , LYS A:42 , LEU A:73 , MET A:74 , ARG A:88 , ARG A:91 , ASP A:95 , TYR A:98 , GLU A:99 , LEU A:102 , MET A:105 , ASN A:106 , SER A:128 , SER A:129 , SER A:130 , GLU A:134 , HIS A:138 , HOH A:165 , HOH A:168 , HOH A:172 , HOH A:173 , HOH A:184 , HOH A:201 , HOH A:212 , HOH A:218 , HOH A:225 , HOH A:230 , HOH A:244 , HOH A:256 , HOH A:286 , HOH A:291 , HOH A:294 , HOH A:295 , HOH A:297 , HOH A:298	BINDING SITE FOR RESIDUE COA A 301

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:159
 aligned with COAD_YERPE | Q8ZJN9 from UniProtKB/Swiss-Prot  Length:159

    Alignment length:159
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150         
           COAD_YERPE     1 MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPMFTLDERVALAKKVTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLESVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA 159
               SCOP domains d3l92a_ A: automated matches                                                                                                                                    SCOP domains
               CATH domains 3l92A00 A:1-159 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                           CATH domains
               Pfam domains -----CTP_transf_2-3l92A01 A:6-135                                                                                                      ------------------------ Pfam domains
         Sec.struct. author ...eeeeee.....hhhhhhhhhhhhhhh.eeeeeee.hhhhh...hhhhhhhhhhhhhh....eeeeee..hhhhhhhhh...eeeee..hhhhhhhhhhhhhhhhhhh...eeeee.........hhhhhhhhhhh........hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3l92 A   1 MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPMFTLDERVALAKKVTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLESVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA 159
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (9, 9)

Asymmetric Unit(hide GO term definitions)

Chain A (COAD_YERPE | Q8ZJN9)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0016779	nucleotidyltransferase activity	Catalysis of the transfer of a nucleotidyl group to a reactant.
	GO:0004595	pantetheine-phosphate adenylyltransferase activity	Catalysis of the reaction: ATP + pantetheine 4'-phosphate = 3'-dephospho-CoA + diphosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0009058	biosynthetic process	The chemical reactions and pathways resulting in the formation of substances; typically the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.
	GO:0015937	coenzyme A biosynthetic process	The chemical reactions and pathways resulting in the formation of coenzyme A, 3'-phosphoadenosine-(5')diphospho(4')pantatheine, an acyl carrier in many acylation and acyl-transfer reactions in which the intermediate is a thiol ester.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		COA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Asp A:12 - Pro A:13	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	3l92
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	COAD_YERPE \| Q8ZJN9
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.7.3
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	COAD_YERPE \| Q8ZJN9
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description