Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL COMPLEX OF N-TERMINAL HUMAN MALTASE-GLUCOAMYLASE WITH BJ2661
 
Authors :  L. Sim, D. R. Rose
Date :  21 Dec 09  (Deposition) - 09 Feb 10  (Release) - 09 Feb 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A
Keywords :  Glycoside Hydrolase Family 31, Cell Membrane, Disulfide Bond, Glycoprotein, Glycosidase, Hydrolase, Membrane, Multifunctional Enzyme, Polymorphism, Signal-Anchor, Sulfation, Transmembrane (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Sim, K. Jayakanthan, S. Mohan, R. Nasi, B. D. Johnston, B. M. Pinto, D. R. Rose
New Glucosidase Inhibitors From An Ayurvedic Herbal Treatment For Type 2 Diabetes: Structures And Inhibition Of Human Intestinal Maltase-Glucoamylase With Compounds From Salacia Reticulata.
Biochemistry V. 49 443 2010
PubMed-ID: 20039683  |  Reference-DOI: 10.1021/BI9016457

(-) Compounds

Molecule 1 - MALTASE-GLUCOAMYLASE, INTESTINAL
    ChainsA
    EC Number3.2.1.20, 3.2.1.3
    EngineeredYES
    Expression SystemDROSOPHILA MELANOGASTER
    Expression System PlasmidPMT-BIP-V5-HIS
    Expression System StrainS2 CELLS
    Expression System Taxid7227
    Expression System Vector TypeSTABLE TRANSFECTION PLASMID
    FragmentUNP RESIDUES 87-954
    GeneMGA, MGAM, MGAML
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMALTASE, ALPHA-GLUCOSIDASE, GLUCOAMYLASE, GLUCAN 1,4-ALPHA-GLUCOSIDASE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric/Biological Unit (2, 3)
No.NameCountTypeFull Name
1BJ11Ligand/Ion(1R,2S)-1-[(1S)-1,2-DIHYDROXYETHYL]-3-[(2R,3S,4S)-3,4-DIHYDROXY-2-(HYDROXYMETHYL)TETRAHYDROTHIOPHENIUM-1-YL]-2-HYDROXYPROPYL SULFATE
2NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:203 , TYR A:299 , ASP A:327 , ILE A:328 , ILE A:364 , TRP A:441 , ASP A:443 , PHE A:450 , ARG A:526 , TRP A:539 , ASP A:542 , PHE A:575 , HIS A:600 , HOH A:4118 , HOH A:4154 , HOH A:4188BINDING SITE FOR RESIDUE BJ1 A 1001
2AC2SOFTWAREARG A:145 , SER A:146 , ASN A:147 , GLN A:739 , PRO A:740 , ASN A:741 , ALA A:746 , ASN A:750 , HOH A:4106 , HOH A:4158 , HOH A:4241 , HOH A:4373 , HOH A:4386BINDING SITE FOR RESIDUE NAG A 2001
3AC3SOFTWARELYS A:389 , ASN A:393 , GLY A:397 , VAL A:398 , VAL A:487 , GLN A:488 , HIS A:489 , HOH A:4179BINDING SITE FOR RESIDUE NAG A 2002

(-) SS Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1A:15 -A:31
2A:26 -A:44
3A:573 -A:584

(-) Cis Peptide Bonds  (5, 5)

Asymmetric/Biological Unit
No.Residues
1Ala A:38 -Val A:39
2Gln A:136 -Pro A:137
3Gly A:181 -Glu A:182
4Ala A:248 -Pro A:249
5Glu A:446 -Val A:447

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (3, 3)

Asymmetric/Biological Unit (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_047350Q404HMGA_HUMANPolymorphism2272330AQ318H
2UniProtVAR_047351S542LMGA_HUMANPolymorphism10266732AS456L
3UniProtVAR_047352N858DMGA_HUMANPolymorphism2960746AD772D

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (4, 4)

Asymmetric/Biological Unit (4, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1P_TREFOIL_2PS51448 P-type 'Trefoil' domain profile.MGA_HUMAN88-134
954-1000
  1-
A:868-868
2P_TREFOIL_1PS00025 P-type 'Trefoil' domain signature.MGA_HUMAN98-119  1A:12-33
3GLYCOSYL_HYDROL_F31_1PS00129 Glycosyl hydrolases family 31 active site.MGA_HUMAN525-532
1416-1423
  1A:439-446
-
4GLYCOSYL_HYDROL_F31_2PS00707 Glycosyl hydrolases family 31 signature 2.MGA_HUMAN655-685  1A:569-599

(-) Exons   (0, 0)

(no "Exon" information available for 3L4T)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:856
 aligned with MGA_HUMAN | O43451 from UniProtKB/Swiss-Prot  Length:1857

    Alignment length:863
                                   103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673       683       693       703       713       723       733       743       753       763       773       783       793       803       813       823       833       843       853       863       873       883       893       903       913       923       933       943       953   
            MGA_HUMAN    94 NELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDNGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWSI 956
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains Trefoil-3l4tA02 A:8-47                  -------------------------    ------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------Glyco_hydro_31-3l4tA01 A:263-735                                                                                                                                                                                                                                                                                                                                                                                                                                                         ----------------------------------------------------------------------------------------------------- --------------------------------- Pfam domains
         Sec.struct. author hhhhh.........hhhhhhhh..ee...-......ee......eee....ee...eeeeeeee.----.......eeeeeeeeee..eeeeeeee..........-..............eeeeee....eeeeee....eeeee.hhh..eee..eeeeeee.....eeeee.............eeeee.................eeeeeee......eeeeee.....eeeeee...eeeeee....eeeeeeee.hhhhhhhhhhhhhh.....hhhhh.eee......hhhhhhhhhhhhhhh.....eeeehhhhh..............hhhhhhhhhhhh..eeeeee...ee........hhhhhhhhhh..............eee..eeee.....hhhhhhhhhhhhhhhhh.....eeee.............................hhhhh..........ee..eehhhhh.hhhhhhhhhhhhhhhhhh......eee.....hhhhh.eee......hhhhhhhhhhhhhhhhhh....ee.ee.......hhhhhhhhhhhhh....eee.........hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eehhhhhhh.hhhhh.....eee...eeee........eeeeee....eee...........eeeeee......eeeee..eeeeee....hhhhhh...eeeeee......eeeeeee..............eeeeeeee..eeeeeeeee........eeeeeeee.....eeeeee......-...eeeee....eeeeeeeeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------H-----------------------------------------------------------------------------------------------------------------------------------------L---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D-------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) P_TREFOIL_2  PDB: - UniProt: 88-134      ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GLYCOSYL--------------------------------------------------------------------------------------------------------------------------GLYCOSYL_HYDROL_F31_2          ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------P_T PROSITE (1)
                PROSITE (2) ----P_TREFOIL_1           --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3l4t A   8 NELERINCIPDQPPTKATCDQRGCCWNPQ-AVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNL----VFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPH-HVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPS-TSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH 870
                                    17        27        |-|       47        57        67    |   77        87        97       107     | 117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667       677       687       697       707       717       727       737       747       757       767       777       787       797       807       817       827        |-|      847       857       867   
                                                       36 |                                72   77                                 113 |                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              836 |                                
                                                         38                                                                          115                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                838                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3L4T)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3L4T)

(-) Pfam Domains  (2, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (19, 19)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (MGA_HUMAN | O43451)
molecular function
    GO:0004558    alpha-1,4-glucosidase activity    Catalysis of the hydrolysis of terminal, non-reducing alpha-(1->4)-linked alpha-D-glucose residues with release of alpha-D-glucose.
    GO:0016160    amylase activity    Catalysis of the hydrolysis of amylose or an amylose derivative.
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0004339    glucan 1,4-alpha-glucosidase activity    Catalysis of the hydrolysis of terminal (1->4)-linked alpha-D-glucose residues successively from non-reducing ends of the chains with release of beta-D-glucose.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016798    hydrolase activity, acting on glycosyl bonds    Catalysis of the hydrolysis of any glycosyl bond.
    GO:0004553    hydrolase activity, hydrolyzing O-glycosyl compounds    Catalysis of the hydrolysis of any O-glycosyl bond.
    GO:0032450    maltose alpha-glucosidase activity    Catalysis of the reaction: alpha-maltose + H2O = 2 alpha-D-glucose.
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0000023    maltose metabolic process    The chemical reactions and pathways involving the disaccharide maltose (4-O-alpha-D-glucopyranosyl-D-glucopyranose), an intermediate in the catabolism of glycogen and starch.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0044245    polysaccharide digestion    The whole of the physical, chemical, and biochemical processes carried out by living organisms to break down ingested polysaccharides into components that may be easily absorbed and directed into metabolism.
    GO:0005983    starch catabolic process    The chemical reactions and pathways resulting in the breakdown of starch, the most important reserve polysaccharide in plants.
cellular component
    GO:0016324    apical plasma membrane    The region of the plasma membrane located at the apical end of the cell.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BJ1  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:248 - Pro A:249   [ RasMol ]  
    Ala A:38 - Val A:39   [ RasMol ]  
    Gln A:136 - Pro A:137   [ RasMol ]  
    Glu A:446 - Val A:447   [ RasMol ]  
    Gly A:181 - Glu A:182   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3l4t
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MGA_HUMAN | O43451
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.20
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
  3.2.1.3
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MGA_HUMAN | O43451
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MGA_HUMAN | O434512qly 2qmj 3ctt 3l4u 3l4v 3l4w 3l4x 3l4y 3l4z 3ton 3top

(-) Related Entries Specified in the PDB File

3l4u 3l4v 3l4w 3l4x 3l4y 3l4z