Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF BACILLUS ANTHRACIS HEML-1, GLUTAMATE SEMIALDEHYDE AMINOTRANSFERASE
 
Authors :  S. M. Anderson, Z. Wawrzak, E. Gordon, J. Hasseman, A. Edwards, A. Savch W. F. Anderson, Center For Structural Genomics Of Infectious D (Csgid)
Date :  18 Dec 09  (Deposition) - 19 Jan 10  (Release) - 14 Dec 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.05
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Alpha Beta Class, Plp-Dependent Transferase-Like, Bacillus Anthracis, Csgid, Porphyrin Biosynthesis, Pyridoxal Phosphate, Structural Genomics, Center For Structural Genomics Of Infectious Diseases, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. M. Anderson, Z. Wawrzak, E. Gordon, J. Hasseman, A. Edwards, A. Savchenko, W. F. Anderson, Center For Structural Genomics Of Infectious Diseases (Csgid)
Crystal Structure Of Bacillus Anthracis Heml-1, Glutamate Semialdehyde Aminotransferase
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE 1
    ChainsA, B
    EC Number5.4.3.8
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21-CODONPLUS(DE3)-RIPL
    Expression System Taxid469008
    GeneHEML1, BA_0531, GBAA_0531, BAS0499
    Organism CommonANTHRAX,ANTHRAX BACTERIUM
    Organism ScientificBACILLUS ANTHRACIS
    Organism Taxid261594
    StrainAMES ANCESTOR
    SynonymGSA 1, GLUTAMATE-1-SEMIALDEHYDE AMINOTRANSFERASE 1, GSA-AT 1

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 25)

Asymmetric/Biological Unit (2, 25)
No.NameCountTypeFull Name
1LLP2Mod. Amino Acid2-LYSINE(3-HYDROXY-2-METHYL-5-PHOSPHONOOXYMETHYL-PYRIDIN-4-YLMETHANE)
2MSE23Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3L44)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3L44)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1Ala A:292 -Pro A:293
2Ala B:158 -Gly B:159
3Ala B:292 -Pro B:293

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3L44)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1AA_TRANSFER_CLASS_3PS00600 Aminotransferases class-III pyridoxal-phosphate attachment site.GSA1_BACAN239-275
 
  2A:239-275
B:239-275

(-) Exons   (0, 0)

(no "Exon" information available for 3L44)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:426
 aligned with GSA1_BACAN | Q81YV0 from UniProtKB/Swiss-Prot  Length:434

    Alignment length:433
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430   
           GSA1_BACAN     1 MVVKFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPIAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKMLKEAMPALDKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPQSIAQEVITVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPKPGFLEKVNELVHEAGALVIYDEVITAFRFMYGGAQDLLGVTPDLTALGKVIGGGLPIGAYGGKKEIMEQVAPLGPAYQAGTMAGNPASMASGIACLEVLQQEGLYEKLDELGAMLEKGILEQAAKHNIDITLNRLKGALTVYFTTNTIEDYDAAQDTDGEMFGKFFKLMLQEGVNLAPSKYEAWFLTTEHTKEDIEYTIEAVGRAFAALADN 433
               SCOP domains d3l44a_ A: automated matches                                                                                                                                                                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhh.hhhhhhhhhh......eeeee..eeee....eeee.hhhhh.......hhhhhhhhhhhhhhh......hhhhhhhhhhhhhhh....eeeee.hhhhhhhhhhhhhhhhhh..eeeee.......hhhh.ee-------..ee.....hhhhhh.eeee...hhhhhhhhhhhhh..eeeeee..............hhhhhhhhhhhh...eeeee...........hhhhhhh....eeeee.hhhh....eeeeehhhhhh................hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh...eeeeee..eeeeee......hhhhhhhhhhhhhhhhhhhhhhh.ee........ee.....hhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AA_TRANSFER_CLASS_3  PDB: A:239-275  -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3l44 A   1 mVVKFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPIAmERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKmLKEAmPALDKVRFVNSGTEAVmTTIRVARAYTGRTKImKFAGCYHGHSDLVLVA-------LGTPDSAGVPQSIAQEVITVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPKPGFLEKVNELVHEAGALVIYDEVITAFRFmYGGAQDLLGVTPDLTALGkVIGGGLPIGAYGGKKEImEQVAPLGPAYQAGTmAGNPASmASGIACLEVLQQEGLYEKLDELGATLEKGILEQAAKHNIDITLNRLKGALTVYFTTNTIEDYDAAQDTDGEmFGKFFKLmLQEGVNLAPSKYEAWFLTTEHTKEDIEYTIEAVGRAFAALADN 433
                            |       10        20        30        40|       50        60        70        80        90       100  |    110       120    |  130       140|      150      |  -    |  170       180       190       200       210       220       230       240       250|      260       270       280       290       300  |    310       320       330       340       350       360       370       380 |     390       400       410       420       430   
                            |                                      41-MSE                                                       103-MSE|              125-MSE         141-MSE         157     165                                                                                   251-MSE            270-LLP           288-MSE        303-MSE  |                                                                     382-MSE 390-MSE                                       
                            1-MSE                                                                                                    108-MSE                                                                                                                                                                                                   310-MSE                                                                                                                       

Chain B from PDB  Type:PROTEIN  Length:433
 aligned with GSA1_BACAN | Q81YV0 from UniProtKB/Swiss-Prot  Length:434

    Alignment length:433
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431   
           GSA1_BACAN     2 VVKFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPIAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKMLKEAMPALDKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPQSIAQEVITVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPKPGFLEKVNELVHEAGALVIYDEVITAFRFMYGGAQDLLGVTPDLTALGKVIGGGLPIGAYGGKKEIMEQVAPLGPAYQAGTMAGNPASMASGIACLEVLQQEGLYEKLDELGAMLEKGILEQAAKHNIDITLNRLKGALTVYFTTNTIEDYDAAQDTDGEMFGKFFKLMLQEGVNLAPSKYEAWFLTTEHTKEDIEYTIEAVGRAFAALADNK 434
               SCOP domains d3l44b_ B: automated matches                                                                                                                                                                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhh.hhhhhhhhhh......eeeee..eeee....eeee.hhhhh.......hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhh....eeeee.hhhhhhhhhhhhhhhhhh..eeeee.......hhhh.ee.........ee.....hhhhhh.eeee...hhhhhhhhhhhhh..eeeeee..............hhhhhhhhhhhhh..eeeee...........hhhhhhh....eeeee.hhhh....eeeeehhhhhh................hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh....eeeee..eeeee.......hhhhhhh.hhhhhhhhhhhhhhh.ee........ee.....hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AA_TRANSFER_CLASS_3  PDB: B:239-275  --------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3l44 B   2 VVKFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPIAmERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKmLKEAmPALDKVRFVNSGTEAVmTTIRVARAYTGRTKImKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPQSIAQEVITVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPKPGFLEKVNELVHEAGALVIYDEVITAFRFmYGGAQDLLGVTPDLTALGkVIGGGLPIGAYGGKKEImEQVAPLGPAYQAGTmAGNPASmASGIACLEVLQQEGLYEKLDELGATLEKGILEQAAKHNIDITLNRLKGALTVYFTTNTIEDYDAAQDTDGEmFGKFFKLmLQEGVNLAPSKYEAWFLTTEHTKEDIEYTIEAVGRAFAALADNK 434
                                    11        21        31        41        51        61        71        81        91       101 |    |111       121   |   131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281      |291       301 |     311       321       331       341       351       361       371       381|      391       401       411       421       431   
                                                                  41-MSE                                                       103-MSE|              125-MSE         141-MSE                                                                                                       251-MSE            270-LLP           288-MSE        303-MSE  |                                                                     382-MSE 390-MSE                                        
                                                                                                                                    108-MSE                                                                                                                                                                                                   310-MSE                                                                                                                        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3L44)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3L44)

(-) Gene Ontology  (9, 9)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (GSA1_BACAN | Q81YV0)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0042286    glutamate-1-semialdehyde 2,1-aminomutase activity    Catalysis of the reaction: (S)-4-amino-5-oxopentanoate = 5-aminolevulinate.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0030170    pyridoxal phosphate binding    Interacting selectively and non-covalently with pyridoxal 5' phosphate, 3-hydroxy-5-(hydroxymethyl)-2-methyl4-pyridine carboxaldehyde 5' phosphate, the biologically active form of vitamin B6.
    GO:0008483    transaminase activity    Catalysis of the transfer of an amino group to an acceptor, usually a 2-oxo acid.
biological process
    GO:0006779    porphyrin-containing compound biosynthetic process    The chemical reactions and pathways resulting in the formation of any member of a large group of derivatives or analogs of porphyrin. Porphyrin consists of a ring of four pyrrole nuclei linked each to the next at their alpha positions through a methine group.
    GO:0006782    protoporphyrinogen IX biosynthetic process    The chemical reactions and pathways resulting in the formation of protoporphyrinogen IX.
    GO:0033014    tetrapyrrole biosynthetic process    The chemical reactions and pathways leading to the formation of tetrapyrroles, natural pigments containing four pyrrole rings joined by one-carbon units linking position 2 of one pyrrole ring to position 5 of the next.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    LLP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3l44)
 
  Cis Peptide Bonds
    Ala A:292 - Pro A:293   [ RasMol ]  
    Ala B:158 - Gly B:159   [ RasMol ]  
    Ala B:292 - Pro B:293   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3l44
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GSA1_BACAN | Q81YV0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.4.3.8
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GSA1_BACAN | Q81YV0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3L44)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3L44)