Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A HYPOTHETICAL PROTEIN FROM STAPHYLOCOCCUS AUREUS
 
Authors :  R. Lam, T. Chan, K. P. Battaile, V. Mihajlovic, V. Romanov, M. Soloveych G. Kisselman, T. E. Mcgrath, K. Lam, E. F. Pai, N. Y. Chirgadze
Date :  14 Dec 09  (Deposition) - 27 Oct 10  (Release) - 27 Oct 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.45
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Hypothetical Protein, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Lam, T. Chan, K. P. Battaile, V. Mihajlovic, V. Romanov, E. F. Pai, N. Y. Chirgadze
Crystal Structure Of A Hypothetical Protein From Staphylococcus Aureus
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE UNCHARACTERIZED PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PW2
    Expression System Strain: BL21(DE3)CODONPLUS RIPL
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: SAUSA300_2529
    Organism Scientific: STAPHYLOCOCCUS AUREUS
    Organism Taxid: 367830
    Strain: USA300

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 11)

Asymmetric/Biological Unit (1, 11)
No.NameCountTypeFull Name
1MSE11Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3L20)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3L20)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3L20)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3L20)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3L20)

(-) Exons   (0, 0)

(no "Exon" information available for 3L20)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:154
 aligned with A0A0H2XH33_S | A0A0H2XH33 from UniProtKB/TrEMBL  Length:149

    Alignment length:154
                                  1                                                                                                                                                   
                                  |  4        14        24        34        44        54        64        74        84        94       104       114       124       134       144    
         A0A0H2XH33_S     - ------MTALFPYIAFENSKEALAYYEEVFGATDVKRLEVGEEQASHFGMTKEEAQEATMHAEFEVLGVKVLCSDSFGRADKINNGISLLIDYDVNNKEDADKVEAFYEQIKDHSSIEIELPFADQFWGGKMGVFTDKYGVRWMLHGQDYTAIQ 148
               SCOP domains d3l20a_ A: automated matches                                                                                                                               SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeeee.hhhhhhhhhhhhh..eeeeeee...........hhhhhhh.eeeeeeee..eeeeeee...........eeeeeeee..hhhhhhhhhhhhhhhh.....eeeeeeee.....eeeeee.....eeeeeee...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3l20 A  -2 GSHmFYmTALFPYIAFENSKEALAYYEEVFGATDVKRLEVGEEQASHFGmTKEEAQEATmHAEFEVLGVKVLCSDSFGRADKINNGISLLIDYDVNNKEDADKVEAFYEQIKDHSSIEIELPFADQFWGGKmGVFTDKYGVRWmLHGQDYTAIQ 151
                               |  |  7        17        27        37        47        57        67        77        87        97       107       117       127 |     137   |   147    
                               |  |                                         47-MSE    57-MSE                                                                 129-MSE     141-MSE      
                               1-MSE                                                                                                                                                  
                                  4-MSE                                                                                                                                               


Chain B from PDB  Type:PROTEIN  Length:145
 aligned with A0A0H2XH33_S | A0A0H2XH33 from UniProtKB/TrEMBL  Length:149

    Alignment length:145
                             1                                                                                                                                               
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139     
         A0A0H2XH33_S     - -MTALFPYIAFENSKEALAYYEEVFGATDVKRLEVGEEQASHFGMTKEEAQEATMHAEFEVLGVKVLCSDSFGRADKINNGISLLIDYDVNNKEDADKVEAFYEQIKDHSSIEIELPFADQFWGGKMGVFTDKYGVRWMLHGQDY 144
               SCOP domains d3l20b_ B: automated matches                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeee.hhhhhhhhhhhhh..eeeeeee...........hhhhhh..eeeeeeee..eeeeeee...........eeeeeeee..hhhhhhhhhhhhhhhh.....eeeeeeee.....eeeeee.....eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3l20 B   3 YmTALFPYIAFENSKEALAYYEEVFGATDVKRLEVGEEQASHFGmTKEEAQEATmHAEFEVLGVKVLCSDSFGRADKINNGISLLIDYDVNNKEDADKVEAFYEQIKDHSSIEIELPFADQFWGGKmGVFTDKYGVRWmLHGQDY 147
                             |      12        22        32        42    |   52    |   62        72        82        92       102       112       122      |132       142     
                             4-MSE                                     47-MSE    57-MSE                                                                 129-MSE     141-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3L20)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3L20)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3L20)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3l20)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3l20)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3l20
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0A0H2XH33_S | A0A0H2XH33
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A0A0H2XH33_S | A0A0H2XH33
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3L20)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3L20)