Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  TON1285, AN INTRACELLULAR PROTEASE FROM THERMOCOCCUS ONNURINEUS NA1
 
Authors :  H. J. Jung, S. S. Cha
Date :  11 Dec 09  (Deposition) - 15 Dec 10  (Release) - 15 Dec 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.78
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Gatase1_pfpi_like, Protease, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. J. Jung, S. S. Cha
Structure Based Classification Of The Dj-1 Superfamily: The Relationship Between Homologous Structures And Various Functions
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - INTRACELLULAR PROTEASE I
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET24A
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Gene: INTRACELLULAR PROTEASE I
    Organism Scientific: THERMOCOCCUS ONNURINEUS
    Organism Taxid: 523850
    Strain: NA1

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3L18)

(-) Sites  (0, 0)

(no "Site" information available for 3L18)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3L18)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3L18)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3L18)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3L18)

(-) Exons   (0, 0)

(no "Exon" information available for 3L18)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:168
 aligned with B6YXG0_THEON | B6YXG0 from UniProtKB/TrEMBL  Length:166

    Alignment length:168
                              1                                                                                                                                                                     
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158        
         B6YXG0_THEON     - --MKVLFLSADGFEDLELIYPLHRIKEEGHEVYVASFQRGKITGKHGYSVNVDLTFEEVDPDEFDALVLPGGKAPEIVRLNEKAVMITRRMFEDDKPVASICHGPQILISAKVLKGRRGTSTITIRDDVINAGAEWIDAEVVVDGNWVSSRHPGDLYAWMREFVKLLH 166
               SCOP domains d3l18a_ A: automated matches                                                                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee.....hhhhhhhhhhhhhhh..eeeeee...eeee.....eeee.ee.hhhhhhhh.eeee...hhhhhhh.hhhhhhhhhhhhhh...eeee..hhhhhhhh......ee..hhhhhhhhhhh..ee.....eee..eeee.hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3l18 A  -1 ASMKVLFLSADGFEDLELIYPLHRIKEEGHEVYVASFQRGKITGKHGYSVNVDLTFEEVDPDEFDALVLPGGKAPEIVRLNEKAVMITRRMFEDDKPVASICHGPQILISAKVLKGRRGTSTITIRDDVINAGAEWIDAEVVVDGNWVSSRHPGDLYAWMREFVKLLH 166
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158        


Chain B from PDB  Type:PROTEIN  Length:167
 aligned with B6YXG0_THEON | B6YXG0 from UniProtKB/TrEMBL  Length:166

    Alignment length:167
                             1                                                                                                                                                                     
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       
         B6YXG0_THEON     - -MKVLFLSADGFEDLELIYPLHRIKEEGHEVYVASFQRGKITGKHGYSVNVDLTFEEVDPDEFDALVLPGGKAPEIVRLNEKAVMITRRMFEDDKPVASICHGPQILISAKVLKGRRGTSTITIRDDVINAGAEWIDAEVVVDGNWVSSRHPGDLYAWMREFVKLLH 166
               SCOP domains d3l18b_ B: automated matches                                                                                                                                            SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----------------------------DJ-1_PfpI-3l18B01 B:29-166                                                                                                                 Pfam domains (1)
           Pfam domains (2) -----------------------------DJ-1_PfpI-3l18B02 B:29-166                                                                                                                 Pfam domains (2)
         Sec.struct. author ..eeeee.....hhhhhhhhhhhhhhh..eeeeee...eeee.....eeee.ee.hhhhhhhh.eeee...hhhhhhh.hhhhhhhhhhhhhh...eeee..hhhhhhhhh.....ee..hhhhhhhhhhh..ee.....eee..eeee.hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3l18 B   0 SMKVLFLSADGFEDLELIYPLHRIKEEGHEVYVASFQRGKITGKHGYSVNVDLTFEEVDPDEFDALVLPGGKAPEIVRLNEKAVMITRRMFEDDKPVASICHGPQILISAKVLKGRRGTSTITIRDDVINAGAEWIDAEVVVDGNWVSSRHPGDLYAWMREFVKLLH 166
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3L18)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: Glutaminase_I (73)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (B6YXG0_THEON | B6YXG0)
molecular function
    GO:0016798    hydrolase activity, acting on glycosyl bonds    Catalysis of the hydrolysis of any glycosyl bond.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
biological process
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3l18)
 
  Sites
(no "Sites" information available for 3l18)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3l18)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3l18
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B6YXG0_THEON | B6YXG0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  B6YXG0_THEON | B6YXG0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3L18)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3L18)