Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  MURA DEAD-END COMPLEX WITH FOSFOMYCIN
 
Authors :  E. Schonbrunn
Date :  17 Nov 09  (Deposition) - 28 Apr 10  (Release) - 27 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A
Keywords :  Closed Enzyme State, Inside-Out Alpha/Beta Barrel, Cell Cycle, Cell Division, Cell Shape, Cell Wall Biogenesis/Degradation, Peptidoglycan Synthesis, Transferase, Transferase-Antibiotic Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Han, Y. Yang, S. H. Olesen, A. Becker, S. Betzi, E. Schonbrunn
The Fungal Product Terreic Acid Is A Covalent Inhibitor Of The Bacterial Cell Wall Biosynthetic Enzyme Udp-N-Acetylglucosamine 1-Carboxyvinyltransferase (Mura) .
Biochemistry V. 49 4276 2010
PubMed-ID: 20392080  |  Reference-DOI: 10.1021/BI100365B

(-) Compounds

Molecule 1 - UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYLTRANSFERASE
    ChainsA
    EC Number2.5.1.7
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET41A
    Expression System StrainBL21
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneB3189, JW3156, MURA, MURA (MURZ), MURZ
    Organism ScientificESCHERICHIA COLI
    Organism Taxid83333
    StrainK12
    SynonymENOYLPYRUVATE TRANSFERASE, UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE, EPT

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 3)

Asymmetric/Biological Unit (3, 3)
No.NameCountTypeFull Name
1FFQ1Ligand/Ion[(1R)-1-HYDROXYPROPYL]PHOSPHONIC ACID
2IAS1Mod. Amino AcidBETA-L-ASPARTIC ACID
3UD11Ligand/IonURIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELYS A:22 , ARG A:91 , GLY A:114 , CYS A:115 , ARG A:120 , ARG A:397 , HOH A:446 , UD1 A:450 , HOH A:496BINDING SITE FOR RESIDUE FFQ A 500
2AC2SOFTWAREASN A:23 , ARG A:91 , TRP A:95 , ARG A:120 , PRO A:121 , VAL A:122 , ASP A:123 , LEU A:124 , HIS A:125 , LYS A:160 , SER A:162 , VAL A:163 , GLY A:164 , THR A:304 , ASP A:305 , VAL A:327 , PHE A:328 , ARG A:331 , HOH A:451 , HOH A:455 , HOH A:468 , HOH A:472 , HOH A:476 , HOH A:480 , HOH A:484 , FFQ A:500 , HOH A:509 , HOH A:554 , HOH A:591 , HOH A:598 , HOH A:794BINDING SITE FOR RESIDUE UD1 A 450

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3KR6)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Gly A:8 -Pro A:9
2His A:299 -Pro A:300

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3KR6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3KR6)

(-) Exons   (0, 0)

(no "Exon" information available for 3KR6)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:419
 aligned with MURA_ECOLI | P0A749 from UniProtKB/Swiss-Prot  Length:419

    Alignment length:419
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410         
           MURA_ECOLI     1 MDKFRVQGPTKLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDVDTSMKLLSQLGAKVERNGSVHIDARDVNVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCTIGARPVDLHISGLEQLGATIKLEEGYVKASVDGRLKGAHIVMDKVSVGATVTIMCAATLAEGTTIIENAAREPEIVDTANFLITLGAKISGQGTDRIVIEGVERLGGGVYRVLPDRIETGTFLVAAAISRGKIICRNAQPDTLDAVLAKLRDAGADIEVGEDWISLDMHGKRPKAVNVRTAPHPAFPTDMQAQFTLLNLVAEGTGFITETVFENRFMHVPELSRMGAHAEIESNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKGE 419
               SCOP domains d3kr6a_ A: automated matches                                                                                                                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 3kr6A01           --3kr6A02 A:21-228  [code=3.65.10.10, no name defined]                                                                                                                                                            -3kr6A01 A:1-18,A:230-419  [code=3.65.10.10, no name defined]                                                                                                                                   CATH domains
               Pfam domains -----EPSP_synthase-3kr6A01 A:6-406                                                                                                                                                                                                                                                                                                                                                                                    ------------- Pfam domains
         Sec.struct. author ..eeeeee....eeeee...hhhhhhhhhhhhhhh...eeee....hhhhhhhhhhhhhh..eeee...eeee.........hhhhhhh.hhhhhhhhhhhhhhheeeee...........hhhhhhhhhhh..eeeee..eeeee........eee....hhhhhhhhhhhhh....eeeee....hhhhhhhhhhhhhh..eee.....eeeee.......eeee...hhhhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhhh..eeee...eeeee..........ee.......hhhhhhhhhhhhhhh..eeeee........hhhhhhhh...eeeee..eeeee........eee..hhhhhhhhhhhhhhh.eeeeee.hhhhhh...hhhhhhhh...eeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3kr6 A   1 MDKFRVQGPTKLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDVDTSMKLLSQLGAKVERxGSVHIDARDVNVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCTIGARPVDLHISGLEQLGATIKLEEGYVKASVDGRLKGAHIVMDKVSVGATVTIMCAATLAEGTTIIENAAREPEIVDTANFLITLGAKISGQGTDRIVIEGVERLGGGVYRVLPDRIETGTFLVAAAISRGKIICRNAQPDTLDAVLAKLRDAGADIEVGEDWISLDMHGKRPKAVNVRTAPHPAFPTDMQAQFTLLNLVAEGTGFITETVFENRFMHVPELSRMGAHAEIESNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKGE 419
                                    10        20        30        40        50        60      | 70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410         
                                                                                             67-IAS                                                                                                                                                                                                                                                                                                                                                            

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: EPT_RTPC (43)

(-) Gene Ontology  (12, 12)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (MURA_ECOLI | P0A749)
molecular function
    GO:0008760    UDP-N-acetylglucosamine 1-carboxyvinyltransferase activity    Catalysis of the reaction: phosphoenolpyruvate + UDP-N-acetyl-alpha-D-glucosamine = phosphate + UDP-N-acetyl-3-O-(1-carboxyvinyl)-D-glucosamine.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016765    transferase activity, transferring alkyl or aryl (other than methyl) groups    Catalysis of the transfer of an alkyl or aryl (but not methyl) group from one compound (donor) to another (acceptor).
biological process
    GO:0019277    UDP-N-acetylgalactosamine biosynthetic process    The chemical reactions and pathways resulting in the formation of UDP-N-acetylgalactosamine, a substance composed of N-acetylgalactosamine, a common structural unit of oligosaccharides, in glycosidic linkage with uridine diphosphate.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:0071555    cell wall organization    A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.
    GO:0009252    peptidoglycan biosynthetic process    The chemical reactions and pathways resulting in the formation of peptidoglycans, any of a class of glycoconjugates found in bacterial cell walls.
    GO:0008360    regulation of cell shape    Any process that modulates the surface configuration of a cell.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FFQ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IAS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UD1  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:8 - Pro A:9   [ RasMol ]  
    His A:299 - Pro A:300   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3kr6
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MURA_ECOLI | P0A749
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.7
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MURA_ECOLI | P0A749
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MURA_ECOLI | P0A7491a2n 1uae 2z2c 3iss 3kqj 3swd

(-) Related Entries Specified in the PDB File

3kqa MURA DEAD-END COMPLEX WITH TERREIC ACID
3kqj MURA BINARY COMPLEX WITH UDP-N-ACETYLGLUCOSAMINE