|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (2, 4) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3KPC) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3KPC) |
PROSITE Motifs (1, 2)
Asymmetric Unit (1, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3KPC) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:124 aligned with Y100_METJA | Q57564 from UniProtKB/Swiss-Prot Length:509 Alignment length:124 395 405 415 425 435 445 455 465 475 485 495 505 Y100_METJA 386 PITLVKDILSKPPITAHSNISIMEAAKILIKHNINHLPIVDEHGKLVGIITSWDIAKALAQNKKTIEEIMTRNVITAHEDEPVDHVAIKMSKYNISGVPVVDDYRRVVGIVTSEDISRLFGGKK 509 SCOP domains d3kpca_ A: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) -----------------------------------------------------------------CBS-3kpcA01 A:451-506 --- Pfam domains (1) Pfam domains (2) -----------------------------------------------------------------CBS-3kpcA02 A:451-506 --- Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------CBS PDB: A:394-450 UniProt: 394-450 ----CBS PDB: A:455-509 UniProt: 455-509 PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript 3kpc A 386 PITLVKDILSKPPITAHSNISIMEAAKILIKHNINHLPIVDEHGKLVGIITSWDIAKALAQNKKTIEEIMTRNVITAHEDEPVDHVAIKMSKYNISGVPVVDDYRRVVGIVTSEDISRLFGGKK 509 395 405 415 425 435 445 455 465 475 485 495 505
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3KPC) |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A (Y100_METJA | Q57564)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|