Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MAOC-LIKE DEHYDRATASE FROM PHYTOPHTHORA CAPSICI
 
Authors :  H. Wang, K. Zhang, J. Guo, Q. Zhou, X. Zheng, F. Sun, H. Pang, X. Zhang
Date :  30 Oct 09  (Deposition) - 10 Nov 10  (Release) - 10 Nov 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Hot Dog Domain, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Wang, K. Zhang, J. Guo, Q. Zhou, X. Zheng, F. Sun, H. Pang, X. Zhang
Crystal Structure Of Maoc-Like Dehydratase From Phytophthor Capsici
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - MAOC-LIKE DEHYDRATASE
    ChainsA, B
    EC Number4.2.1.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET-28A
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism ScientificPHYTOPHTHORA CAPSICI
    Organism Taxid4784

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3KH8)

(-) Sites  (0, 0)

(no "Site" information available for 3KH8)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3KH8)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1Phe A:69 -Pro A:70
2Asp A:79 -Gly A:80
3Phe B:69 -Pro B:70

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3KH8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3KH8)

(-) Exons   (0, 0)

(no "Exon" information available for 3KH8)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:295
 aligned with E3T2G3_PHYCP | E3T2G3 from UniProtKB/TrEMBL  Length:298

    Alignment length:295
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292     
         E3T2G3_PHYCP     3 VNVDKILNSPEATYTATYNQRDLLMYAVGIGESDLQFTYEFDEKFSAFPLYPVCLPFKGQSQDVVPFPPETISAAPDGMPSFNPAMILHGEQSVEILRPLDPSGGTLTGKTKVISFYDKGKGTLMETQTQFEDGNGPVAKLISGSFIRGLTGYEGKGRKLPARVQIPKRQPDFNDEFKTSPHQAQVYRLSGDYNSLHIDPEIAKSVGFKQPILHGLCSMGVASRALFKQFCGGDVARFKSIRVRFSSPCFPGETIQTRMWQEGSGKVLFQAVVKERGAVIVDGGEFVYTQDASAR 297
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh..eeeeeeehhhhhhhhhhhh...hhhhhh..........hhhhhhhhhh.........hhhhhh............eeeeeeeeee........eeeeeeeeeeeeee...eeeeeeeeeeee..eeeeeeeeeeeee.......ee...............eeeeee...hhhhhhhhhh..hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh..hhh.eeeeeeee........eeeeeeee....eeeeeeee....eeeeeeeeeee.hhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3kh8 A   3 VNVDKILNSPEATYTATYNQRDLLMYAVGIGESDLQFTYEFDEKFSAFPLYPVCLPFKGQSQDVVPFPPETISAAPDGMPSFNPAMILHGEQSVEILRPLDPSGGTLTGKTKVISFYDKGKGTLMETQTQFEDGNGPVAKLISGSFIRGLTGYEGKGRKLPARVQIPKRQPDFNDEFKTSPHQAQVYRLSGDYNSLHIDPEIAKSVGFKQPILHGLCSMGVASRALFKQFCGGDVARFKSIRVRFSSPCFPGETIQTRMWQEGSGKVLFQAVVKERGAVIVDGGEFVYTQDASAR 297
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292     

Chain B from PDB  Type:PROTEIN  Length:284
 aligned with E3T2G3_PHYCP | E3T2G3 from UniProtKB/TrEMBL  Length:298

    Alignment length:292
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292  
         E3T2G3_PHYCP     3 VNVDKILNSPEATYTATYNQRDLLMYAVGIGESDLQFTYEFDEKFSAFPLYPVCLPFKGQSQDVVPFPPETISAAPDGMPSFNPAMILHGEQSVEILRPLDPSGGTLTGKTKVISFYDKGKGTLMETQTQFEDGNGPVAKLISGSFIRGLTGYEGKGRKLPARVQIPKRQPDFNDEFKTSPHQAQVYRLSGDYNSLHIDPEIAKSVGFKQPILHGLCSMGVASRALFKQFCGGDVARFKSIRVRFSSPCFPGETIQTRMWQEGSGKVLFQAVVKERGAVIVDGGEFVYTQDA 294
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh..eeeeeeehhhhhhhhhhhh...hhhhhh..........hhhhhhhhhh..........------.....--hhh.eeeeeeeeee........eeeeeeeeeeeeee...eeeeeeeeeee....eeeeeeeeeeee.......ee...............eeeeee...hhhhhhhhhh..hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh..hhh.eeeeeeee........eeeeeeeeee..eeeeeeee....eeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3kh8 B   3 VNVDKILNSPEATYTATYNQRDLLMYAVGIGESDLQFTYEFDEKFSAFPLYPVCLPFKGQSQDVVPFPP------PDGMP--NPAMILHGEQSVEILRPLDPSGGTLTGKTKVISFYDKGKGTLMETQTQFEDGNGPVAKLISGSFIRGLTGYEGKGRKLPARVQIPKRQPDFNDEFKTSPHQAQVYRLSGDYNSLHIDPEIAKSVGFKQPILHGLCSMGVASRALFKQFCGGDVARFKSIRVRFSSPCFPGETIQTRMWQEGSGKVLFQAVVKERGAVIVDGGEFVYTQDA 294
                                    12        22        32        42        52        62        |-     |  82  |     92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292  
                                                                                               71     78  82 85                                                                                                                                                                                                                 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3KH8)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3KH8)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3KH8)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3KH8)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3kh8)
 
  Sites
(no "Sites" information available for 3kh8)
 
  Cis Peptide Bonds
    Asp A:79 - Gly A:80   [ RasMol ]  
    Phe A:69 - Pro A:70   [ RasMol ]  
    Phe B:69 - Pro B:70   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3kh8
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  E3T2G3_PHYCP | E3T2G3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  4.2.1.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  E3T2G3_PHYCP | E3T2G3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3KH8)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3KH8)