|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 5)| Asymmetric Unit (2, 5) Biological Unit 1 (1, 8) Biological Unit 2 (1, 24) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3JZV) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3JZV) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3JZV) |
Exons (0, 0)| (no "Exon" information available for 3JZV) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:148 aligned with Q2RSU5_RHORT | Q2RSU5 from UniProtKB/TrEMBL Length:156 Alignment length:149 17 27 37 47 57 67 77 87 97 107 117 127 137 147 Q2RSU5_RHORT 8 RPFRPFQSQYRWPGVDLLAYKEEGSAPFRSVTRQVLFSGNGLTGELRYFEVGPGGHSTLERHQHAHGVMILKGRGHAMVGRAVSAVAPYDLVTIPGWSWHQFRAPADEALGFLCMVNAERDKPQLPTEADLAMLRADDAVAAFLDGLAG 156 SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------Cupin_2-3jzvA01 A:54-123 --------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3jzv A 8 RPFRPFQSQYRWPGVDLLAYKEE-SAPFRSVTRQVLFSGNGLTGELRYFEVGPGGHSTLERHQHAHGVmILKGRGHAmVGRAVSAVAPYDLVTIPGWSWHQFRAPADEALGFLCmVNAERDKPQLPTEADLAmLRADDAVAAFLDGLAG 156 17 27 | | 37 47 57 67 77 |87 97 107 117 | 127 137 | 147 30 | 76-MSE 85-MSE 122-MSE 140-MSE 32
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3JZV) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3JZV) |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A (Q2RSU5_RHORT | Q2RSU5)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|