|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric Unit (2, 4) Biological Unit 1 (2, 16) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3JU3) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3JU3) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3JU3) |
Exons (0, 0)| (no "Exon" information available for 3JU3) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:116 aligned with Q9HK35_THEAC | Q9HK35 from UniProtKB/TrEMBL Length:629 Alignment length:116 512 522 532 542 552 562 572 582 592 602 612 Q9HK35_THEAC 503 DEKAVLIGEKEADITFVTWGSQKGPILDVIEDLKEEGISANLLYLKMFSPFPTEFVKNVLSSANLVIDVESNYTAQAAQMIKLYTGIDIKNKILKYNGRHMTEDEILKSAKEILNK 618 SCOP domains -------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -Transketolase_C-3ju3A01 A:504-594 ------------------------ Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------- Transcript 3ju3 A 503 AEKAVLIGEKEADITFVTWGSQKGPILDVIEDLKEEGISANLLYLKmFSPFPTEFVKNVLSSANLVIDVESNYTAQAAQmIKLYTGIDIKNKILKYNGRHmTEDEILKSAKEILNK 618 512 522 532 542 |552 562 572 582 592 602| 612 549-MSE 582-MSE 603-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3JU3) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3JU3) |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A (Q9HK35_THEAC | Q9HK35)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|