|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 3)| Asymmetric/Biological Unit (2, 3) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3JSR) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3JSR) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3JSR) |
Exons (0, 0)| (no "Exon" information available for 3JSR) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:108 aligned with Q8Z082_NOSS1 | Q8Z082 from UniProtKB/TrEMBL Length:111 Alignment length:108 10 20 30 40 50 60 70 80 90 100 Q8Z082_NOSS1 1 MKMQTYYYVLASRRFLLQEEPIEEVLKERTRHYHEQEKEIDFWLVPQPAFLEAPEFADIKAKCPQPAAAIISTNSQFITWLKLRLEYVVTGEFSAPSETIPNPLASLA 108 SCOP domains ------------------------------------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ---Ycf54-3jsrA01 A:4-96 ------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------ Transcript 3jsr A 1 mKmQTYYYVLASRRFLLQEEPIEEVLKERTRHYHEQEKEIDFWLVPQPAFLEAPEFADIKAKCPQPAAAIISTNSQFITWLKLRLEYVVTGEFSAPSETIPNPLASLA 108 | | 10 20 30 40 50 60 70 80 90 100 | | 1-MSE 3-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3JSR) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3JSR) |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3JSR)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|