Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  MODEL OF THE HUMAN EIF3 PCI-MPN OCTAMER DOCKED INTO THE 43S-HCV IRES EM MAP
 
Authors :  J. P. Erzberger, N. Ban
Date :  08 Oct 14  (Deposition) - 22 Oct 14  (Release) - 22 Oct 14  (Revision)
Method :  ELECTRON MICROSCOPY
Resolution :  NOT APPLICABLE
Chains :  Asym./Biol. Unit :  A,C,E,F,H,K,L,M
Keywords :  Translation (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. P. Erzberger, F. Stengel, R. Pellarin, S. Zhang, T. Schaefer, C. H. Aylett, P. Cimermancic, D. Boehringer, A. Sali, R. Aebersold, N. Ban
Molecular Architecture Of The 40Seif1Eif3 Translation Initiation Complex.
Cell(Cambridge, Mass. ) V. 158 1123 2014
PubMed-ID: 25171412  |  Reference-DOI: 10.1016/J.CELL.2014.07.044

(-) Compounds

Molecule 1 - EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT A
    ChainsA
    FragmentSEE REMARK 999
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymEIF3A, EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 10, EIF-3-THETA, EIF3 P167, EIF3 P180, EIF3 P185
 
Molecule 2 - EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT C
    ChainsC
    FragmentSEE REMARK 999
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymEIF3C, EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 8, EIF3 P110
 
Molecule 3 - EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT E
    ChainsE
    FragmentSEE REMARK 999
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymEIF3E, EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 6, VIRAL INTEGRATION SITE PROTEIN INT-6 HOMOLOG, EIF-3 P48
 
Molecule 4 - EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT F
    ChainsF
    EC Number3.4.19.12
    FragmentSEE REMARK 999
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymEIF3F, DEUBIQUITINATING ENZYME EIF3F, EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 5, EIF-3-EPSILON, EIF3 P47
 
Molecule 5 - EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT H
    ChainsH
    FragmentSEE REMARK 999
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymEIF3H, EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 3, EIF-3-GAMMA, EIF3 P40 SUBUNIT
 
Molecule 6 - EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT K
    ChainsK
    FragmentSEE REMARK 999
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymEIF3K, EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 12, MUSCLE-SPECIFIC GENE M9 PROTEIN, PLAC-24, EIF-3 P25, EIF-3 P28
 
Molecule 7 - EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT L
    ChainsL
    FragmentSEE REMARK 999
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymEIF3L, EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 6- INTERACTING PROTEIN, EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT E-INTERACTING PROTEIN
 
Molecule 8 - EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT M
    ChainsM
    FragmentSEE REMARK 999
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymEIF3M, FETAL LUNG PROTEIN B5, HFL-B5, PCI DOMAIN-CONTAINING PROTEIN 1

 Structural Features

(-) Chains, Units

  12345678
Asymmetric/Biological Unit ACEFHKLM

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 308)

Asymmetric/Biological Unit (1, 308)
No.NameCountTypeFull Name
1UNK308Mod. Amino Acid

(-) Sites  (0, 0)

(no "Site" information available for 3J8B)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3J8B)

(-) Cis Peptide Bonds  (11, 11)

Asymmetric/Biological Unit
No.Residues
1Gln A:6 -Arg A:7
2Met A:306 -Arg A:307
3Ile A:347 -Ile A:348
4His C:390 -Ala C:391
5Asn C:449 -Gln C:450
6Gly F:176 -His F:177
7Pro F:195 -Asn F:196
8Gly H:126 -Ser H:127
9Leu K:77 -Pro K:78
10Arg K:97 -Pro K:98
11Met L:380 -Arg L:381

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (4, 4)

Asymmetric/Biological Unit (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_014452W172LEIF3F_HUMANPolymorphism1044058FW172L
2UniProtVAR_046480A185VEIF3E_HUMANPolymorphism17856554EA185V
3UniProtVAR_024438E386KEIF3A_HUMANPolymorphism967185AE386K
4UniProtVAR_036754Q346REIF3M_HUMANPolymorphism1802363MX1009R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3J8B)

(-) Exons   (7, 7)

Asymmetric/Biological Unit (7, 7)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002483421ENSE00001235237chr19:39109722-39109967246EIF3K_HUMAN1-20201K:2-2019
1.2ENST000002483422ENSE00000951788chr19:39110977-3911107599EIF3K_HUMAN20-53341K:20-5334
1.3ENST000002483423ENSE00000951789chr19:39114717-39114837121EIF3K_HUMAN53-93411K:53-9341
1.4ENST000002483424ENSE00000951791chr19:39116668-3911674275EIF3K_HUMAN94-118251K:94-11825
1.5ENST000002483425ENSE00000951793chr19:39123070-3912313667EIF3K_HUMAN119-141231K:119-14123
1.6ENST000002483426ENSE00000875473chr19:39123241-3912331878EIF3K_HUMAN141-167271K:141-16727
1.7ENST000002483427ENSE00000951794chr19:39125633-39125758126EIF3K_HUMAN167-209431K:167-1016 (gaps)42
1.8ENST000002483428ENSE00001235229chr19:39127529-3912759567EIF3K_HUMAN209-218100--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:488
 aligned with EIF3A_HUMAN | Q14152 from UniProtKB/Swiss-Prot  Length:1382

    Alignment length:526
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523      
         EIF3A_HUMAN      4 YFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLYHLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLGLQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEKEPELQQYVPQLQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSV  529
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhh..hhhhhhhhhhhhh.hhhhh..hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.-------------------------------------.hhhhhhhhhhhhhhhhhh..hhh.hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh.......hhhhhhh..........hhhhhhh.......hhhhhhhhh.hhhhhh..hhhhhhhhhhhh......hhhhhhhhhhhhhh.hhhhhhhhh.hhhhhhhhhhhhhhhhhhh..eeehhhhhhh.....hhhhhhhhhhhhhh.....eee....eee..-.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------K----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3j8b A    4 YFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEES-------------------------------------LTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLYHLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLGLQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEKEPELQQYVPQLQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFG-xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx 1033
                                    13        23        33        43        53        63        73        83        93       103    |    -         -         -         -  |    153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493| ||||1007||||||1017||||||1027||||||
                                                                                                                                  108                                   146                                                                                                                                                                                                                                                                                                                                                         494 |||||1008-UNK|1017-UNK|1026-UNK|||
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     1000-UNK|1009-UNK|1018-UNK|1027-UNK||
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      1001-UNK|1010-UNK|1019-UNK|1028-UNK|
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       1002-UNK|1011-UNK|1020-UNK|1029-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        1003-UNK 1012-UNK 1021-UNK 1030-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         1004-UNK 1013-UNK 1022-UNK 1031-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          1005-UNK 1014-UNK 1023-UNK 1032-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           1006-UNK 1015-UNK 1024-UNK 1033-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            1007-UNK 1016-UNK 1025-UNK    

Chain C from PDB  Type:PROTEIN  Length:546
 aligned with EIF3C_HUMAN | Q99613 from UniProtKB/Swiss-Prot  Length:913

    Alignment length:547
                                   335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575       585       595       605       615       625       635       645       655       665       675       685       695       705       715       725       735       745       755       765       775       785       795       805       815       825       835       845       855       865       
         EIF3C_HUMAN    326 HAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCINELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNER  872
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhh.....hhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh....................hhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhh....hhhhhhhhhhhhhh..............hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh..hhhhhhhhhhh..hhhhh....hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh...hhhhh....hhhhhhhh..hhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhh.........hhhhhhhhhhhhhh..hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh..eeehhhhhhhh...hhhhhhhhhhhhhhh....eee....eee...-.hhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3j8b C  116 HAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCINELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHR-xxxxxxxxxxxxxxxxxxxxxxxxx 1024
                                   125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575       585       595       605       615       625       635| ||||1007||||||1017|||||||
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  636 |||||1008-UNK|1017-UNK|||
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   1000-UNK|1009-UNK|1018-UNK||
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    1001-UNK|1010-UNK|1019-UNK|
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     1002-UNK|1011-UNK|1020-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      1003-UNK 1012-UNK 1021-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       1004-UNK 1013-UNK 1022-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        1005-UNK 1014-UNK 1023-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         1006-UNK 1015-UNK 1024-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          1007-UNK 1016-UNK    

Chain E from PDB  Type:PROTEIN  Length:384
 aligned with EIF3E_HUMAN | P60228 from UniProtKB/Swiss-Prot  Length:445

    Alignment length:419
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413         
         EIF3E_HUMAN      4 YDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNI  422
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhh.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhh...hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhh---------------------------..hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhh-------....hhhhhhh...........hhhhhhhhhhhhhhh.....hhhhhh.....hhhhhhhhhh.hhhhhhhhhhhh..hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.eeehhhhhhhh..hhhhhhhhhhhhhhh......ee....eee...-.hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------V--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3j8b E    4 YDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVK---------------------------HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSL-------KGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGN-xxxxxxxxxxxxxxxxxxxxxxxxxx 1025
                                    13        23        33        43        53        63        73        83        93         -         -       123       133       143       153       163       173       183       193       203       213     |   -   |   233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393 | |||1006||||||1016|||||||||
                                                                                                                    93                         121                                                                                               219     227                                                                                                                                                                     395 |||||1008-UNK|1017-UNK||||
                                                                                                                                                                                                                                                                                                                                                                                                                                  1000-UNK|1009-UNK|1018-UNK|||
                                                                                                                                                                                                                                                                                                                                                                                                                                   1001-UNK|1010-UNK|1019-UNK||
                                                                                                                                                                                                                                                                                                                                                                                                                                    1002-UNK|1011-UNK|1020-UNK|
                                                                                                                                                                                                                                                                                                                                                                                                                                     1003-UNK 1012-UNK 1021-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                      1004-UNK 1013-UNK 1022-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                       1005-UNK 1014-UNK 1023-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                        1006-UNK 1015-UNK 1024-UNK
                                                                                                                                                                                                                                                                                                                                                                                                                                         1007-UNK 1016-UNK 1025-UNK

Chain F from PDB  Type:PROTEIN  Length:232
 aligned with EIF3F_HUMAN | O00303 from UniProtKB/Swiss-Prot  Length:357

    Alignment length:239
                                    98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318         
         EIF3F_HUMAN     89 GRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETML  327
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeehhhhhhhhhhhhhhhh......eeeeeee....eeeeeeeee..eeee..eeeehhhhhhhhhhhhhhhh...eeeeeee.......hhhhhhhhhhhhh...eeeee..........eeeeeee...........eeeeeeeee..hhhhhhhhhhhh....-.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh------.hhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------L----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3j8b F   89 GRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCF-xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx------xxxxxxxxxxxxxxxxxxxxxxx 1068
                                    98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248        |-||||||1009||||||1019||||||1029||||||1039      1049||||||1059|||||||||
                                                                                                                                                                                                  257 |||||1008-UNK|1017-UNK|1026-UNK|1035-UNK      |1050-UNK|1059-UNK|1068-UNK
                                                                                                                                                                                                   1000-UNK|1009-UNK|1018-UNK|1027-UNK|1036-UNK     ||1051-UNK|1060-UNK||| 
                                                                                                                                                                                                    1001-UNK|1010-UNK|1019-UNK|1028-UNK|1037-UNK    |||1052-UNK|1061-UNK|| 
                                                                                                                                                                                                     1002-UNK|1011-UNK|1020-UNK|1029-UNK|1038-UNK   ||||1053-UNK|1062-UNK| 
                                                                                                                                                                                                      1003-UNK 1012-UNK 1021-UNK 1030-UNK 1039-UNK  |||| 1054-UNK 1063-UNK 
                                                                                                                                                                                                       1004-UNK 1013-UNK 1022-UNK 1031-UNK       1046-UNK 1055-UNK 1064-UNK
                                                                                                                                                                                                        1005-UNK 1014-UNK 1023-UNK 1032-UNK       1047-UNK 1056-UNK 1065-UNK
                                                                                                                                                                                                         1006-UNK 1015-UNK 1024-UNK 1033-UNK       1048-UNK 1057-UNK 1066-UNK
                                                                                                                                                                                                          1007-UNK 1016-UNK 1025-UNK 1034-UNK       1049-UNK 1058-UNK 1067-UNK

Chain H from PDB  Type:PROTEIN  Length:254
                                                                                                                                                                                                                                                                                               
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeehhhhhhhhhhhhhhhhhh...eeeeeeee....eeeeeeee............hhhhhhhhhhhhhhh....eeeeeee.........hhhhhhhhhhhhhh...eeeee...........eeeeee......eee..eeee.hhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3j8b H   37 KQVQIDGLVVLKIIKHYQEEGQGTEVVQGVLLGLVVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWYQSTYYGSFVTRALLDSQFSYQHAIEESVVLIYDPIKTAQGSLSLKAYRLTPFEYMFEEVPIVIKNSHLINVLMWELEKKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx 1120
                                    46        56        66        76        86        96       106       116       126       136       146       156       166    || 198       208       218  ||||1006||||||1016||||||1026||||||1043||||||1076||||||1086||||||1096||||||1106||||||1116||||
                                                                                                                                                                171|                        221|||||1008-UNK|1017-UNK|1026-UNK|1042-UNK|1074-UNK|1083-UNK|1092-UNK|1101-UNK|1110-UNK|1119-UNK
                                                                                                                                                                 194                        1000-UNK|1009-UNK|1018-UNK|1027-UNK|1043-UNK|1075-UNK|1084-UNK|1093-UNK|1102-UNK|1111-UNK|1120-UNK
                                                                                                                                                                                             1001-UNK|1010-UNK|1019-UNK|1035-UNK|1044-UNK|1076-UNK|1085-UNK|1094-UNK|1103-UNK|1112-UNK||  
                                                                                                                                                                                              1002-UNK|1011-UNK|1020-UNK|1036-UNK|1045-UNK|1077-UNK|1086-UNK|1095-UNK|1104-UNK|1113-UNK|  
                                                                                                                                                                                               1003-UNK 1012-UNK 1021-UNK 1037-UNK 1046-UNK 1078-UNK 1087-UNK 1096-UNK 1105-UNK 1114-UNK  
                                                                                                                                                                                                1004-UNK 1013-UNK 1022-UNK 1038-UNK 1047-UNK 1079-UNK 1088-UNK 1097-UNK 1106-UNK 1115-UNK 
                                                                                                                                                                                                 1005-UNK 1014-UNK 1023-UNK 1039-UNK 1071-UNK 1080-UNK 1089-UNK 1098-UNK 1107-UNK 1116-UNK
                                                                                                                                                                                                  1006-UNK 1015-UNK 1024-UNK 1040-UNK 1072-UNK 1081-UNK 1090-UNK 1099-UNK 1108-UNK 1117-UNK
                                                                                                                                                                                                   1007-UNK 1016-UNK 1025-UNK 1041-UNK 1073-UNK 1082-UNK 1091-UNK 1100-UNK 1109-UNK 1118-UNK

Chain K from PDB  Type:PROTEIN  Length:204
 aligned with EIF3K_HUMAN | Q9UBQ5 from UniProtKB/Swiss-Prot  Length:218

    Alignment length:207
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       
         EIF3K_HUMAN      2 AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFD  208
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh.hhhh.hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.hhh..hhhhhhhhhhhhhh...hhhhhhhhh.hhhhhh..hhhhhhhhhhhhhh.hhhhhhhhh...hhhhhh..hhhhhhhhhhhhhhhhhh...hhhhhhhhh...hhhhhhhhhhhhh.....--.....-.hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1           --------------------------------Exon 1.3  PDB: K:53-93 UniProt: 53-93    Exon 1.4  PDB: K:94-118  Exon 1.5  PDB: K:119-14-------------------------Exon 1.7  PDB: K:167-1016 (gaps)           Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.2  PDB: K:20-53            ---------------------------------------------------------------------------------------Exon 1.6  PDB: K:141-167   ----------------------------------------- Transcript 1 (2)
                3j8b K    2 AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADE--QIFIC-xxxxxxxxxxxxxxxxx 1016
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181 |  |   |-||||||1009|||||||
                                                                                                                                                                                                               183  | 190 |||||1008-UNK||||
                                                                                                                                                                                                                  186  1000-UNK|1009-UNK|||
                                                                                                                                                                                                                        1001-UNK|1010-UNK||
                                                                                                                                                                                                                         1002-UNK|1011-UNK|
                                                                                                                                                                                                                          1003-UNK 1012-UNK
                                                                                                                                                                                                                           1004-UNK 1013-UNK
                                                                                                                                                                                                                            1005-UNK 1014-UNK
                                                                                                                                                                                                                             1006-UNK 1015-UNK
                                                                                                                                                                                                                              1007-UNK 1016-UNK

Chain L from PDB  Type:PROTEIN  Length:258
 aligned with EIF3L_HUMAN | Q9Y262 from UniProtKB/Swiss-Prot  Length:564

    Alignment length:274
                                   276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536    
         EIF3L_HUMAN    267 KMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELNKKSMYSRVPECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVARRYG  540
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhh...hhhhhhhhhhh...hhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh................hhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhh..hhhhhhhhhh.hhhhhh---------------.......hhhhhhhhhhhhhhhhhhhh....eehhhhhhhhhhh....hhhhhhhhhhhhhh.............ee.-.hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3j8b L  267 KMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELNKKSMYSRVPECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFSYSCPKFLS---------------EPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQS-xxxxxxxxxxxxxxxxxxxxxxxx 1023
                                   276       286       296       306       316       326       336       346       356       366       376       386       396       406       416     |   -         - |     446       456       466       476       486       496       506        |-||||||1009||||||1019||||
                                                                                                                                                                                     422             438                                                                          515 |||||1008-UNK|1017-UNK||
                                                                                                                                                                                                                                                                                   1000-UNK|1009-UNK|1018-UNK|
                                                                                                                                                                                                                                                                                    1001-UNK|1010-UNK|1019-UNK
                                                                                                                                                                                                                                                                                     1002-UNK|1011-UNK|1020-UNK
                                                                                                                                                                                                                                                                                      1003-UNK 1012-UNK 1021-UNK
                                                                                                                                                                                                                                                                                       1004-UNK 1013-UNK 1022-UNK
                                                                                                                                                                                                                                                                                        1005-UNK 1014-UNK 1023-UNK
                                                                                                                                                                                                                                                                                         1006-UNK 1015-UNK    
                                                                                                                                                                                                                                                                                          1007-UNK 1016-UNK   

Chain M from PDB  Type:PROTEIN  Length:176
 aligned with EIF3M_HUMAN | Q7L2H7 from UniProtKB/Swiss-Prot  Length:374

    Alignment length:177
                                   197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       
         EIF3M_HUMAN    188 LLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKV  364
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh..hhhhhhhhhhhhhh.....hhhhhh..hhh....hhhhhhhhhhhh.hhhhhhhh.hhh.hhhhhhh.hhhhhhhhhhhhhhhhhhhhh.eeehhhhhhhhh.hhhhhhhhhh.hhhhhhh..eee....eee..-.hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------R------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3j8b M  188 LLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVS-xxxxxxxxxxxxxxxxxxxxxxxxxxxx 1027
                                   197       207       217       227       237       247       257       267       277       287       297       307       317       327      1000||||||1010||||||1020|||||||
                                                                                                                                                                             335 |||||1008-UNK|1017-UNK|1026-UNK
                                                                                                                                                                              1000-UNK|1009-UNK|1018-UNK|1027-UNK
                                                                                                                                                                               1001-UNK|1010-UNK|1019-UNK||  
                                                                                                                                                                                1002-UNK|1011-UNK|1020-UNK|  
                                                                                                                                                                                 1003-UNK 1012-UNK 1021-UNK  
                                                                                                                                                                                  1004-UNK 1013-UNK 1022-UNK 
                                                                                                                                                                                   1005-UNK 1014-UNK 1023-UNK
                                                                                                                                                                                    1006-UNK 1015-UNK 1024-UNK
                                                                                                                                                                                     1007-UNK 1016-UNK 1025-UNK

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3J8B)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3J8B)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3J8B)

(-) Gene Ontology  (38, 134)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (EIF3A_HUMAN | Q14152)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
    GO:0003743    translation initiation factor activity    Functions in the initiation of ribosome-mediated translation of mRNA into a polypeptide.
biological process
    GO:0075522    IRES-dependent viral translational initiation    Process by which viral mRNA translation is initiated, where a domain in the 5' untranslated region (UTR) of the viral mRNA called an internal ribosome entry site (IRES) binds the host 43S preinitiation complex, circumventing regular cap-dependent translation initiation.
    GO:0001732    formation of cytoplasmic translation initiation complex    Joining of the large subunit, with release of IF2/eIF2 and IF3/eIF3. This leaves the functional ribosome at the AUG, with the methionyl/formyl-methionyl-tRNA positioned at the P site.
    GO:0001731    formation of translation preinitiation complex    The joining of the small ribosomal subunit, ternary complex, and mRNA.
    GO:0006446    regulation of translational initiation    Any process that modulates the frequency, rate or extent of translational initiation.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
    GO:0006413    translational initiation    The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
    GO:0075525    viral translational termination-reinitiation    A process which occurs as part of viral mRNA translation which allows expression of a downstream open reading frame (ORF) in a dicistronic mRNA. In this process, ribosomes translate the upstream ORF but following termination, a proportion of 40S subunits remain tethered to the mRNA and go on to re-initiate translation at the start codon of the downstream ORF.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016282    eukaryotic 43S preinitiation complex    A protein complex composed of the 40S ribosomal subunit plus eIF1A, eIF3, and eIF2-GTP-bound methionyl-initiator methionine tRNA.
    GO:0033290    eukaryotic 48S preinitiation complex    A protein complex composed of the small ribosomal subunit, eIF3, eIF1A, methionyl-initiatior methionine and a capped mRNA. The complex is initially positioned at the 5'-end of the capped mRNA.
    GO:0005852    eukaryotic translation initiation factor 3 complex    A complex of several polypeptides that plays at least two important roles in protein synthesis: First, eIF3 binds to the 40S ribosome and facilitates loading of the Met-tRNA/eIF2.GTP ternary complex to form the 43S preinitiation complex. Subsequently, eIF3 apparently assists eIF4 in recruiting mRNAs to the 43S complex. The eIF3 complex contains five conserved core subunits, and may contain several additional proteins; the non-core subunits are thought to mediate association of the complex with specific sets of mRNAs.
    GO:0071541    eukaryotic translation initiation factor 3 complex, eIF3m    An eukaryotic translation initiation factor 3 complex that contains the PCI-domain protein eIF3m.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C   (EIF3C_HUMAN | Q99613)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003743    translation initiation factor activity    Functions in the initiation of ribosome-mediated translation of mRNA into a polypeptide.
    GO:0031369    translation initiation factor binding    Interacting selectively and non-covalently with a translation initiation factor, any polypeptide factor involved in the initiation of ribosome-mediated translation.
biological process
    GO:0001731    formation of translation preinitiation complex    The joining of the small ribosomal subunit, ternary complex, and mRNA.
    GO:0006446    regulation of translational initiation    Any process that modulates the frequency, rate or extent of translational initiation.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
    GO:0006413    translational initiation    The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016282    eukaryotic 43S preinitiation complex    A protein complex composed of the 40S ribosomal subunit plus eIF1A, eIF3, and eIF2-GTP-bound methionyl-initiator methionine tRNA.
    GO:0033290    eukaryotic 48S preinitiation complex    A protein complex composed of the small ribosomal subunit, eIF3, eIF1A, methionyl-initiatior methionine and a capped mRNA. The complex is initially positioned at the 5'-end of the capped mRNA.
    GO:0005852    eukaryotic translation initiation factor 3 complex    A complex of several polypeptides that plays at least two important roles in protein synthesis: First, eIF3 binds to the 40S ribosome and facilitates loading of the Met-tRNA/eIF2.GTP ternary complex to form the 43S preinitiation complex. Subsequently, eIF3 apparently assists eIF4 in recruiting mRNAs to the 43S complex. The eIF3 complex contains five conserved core subunits, and may contain several additional proteins; the non-core subunits are thought to mediate association of the complex with specific sets of mRNAs.

Chain E   (EIF3E_HUMAN | P60228)
molecular function
    GO:0047485    protein N-terminus binding    Interacting selectively and non-covalently with a protein N-terminus, the end of any peptide chain at which the 2-amino (or 2-imino) function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003743    translation initiation factor activity    Functions in the initiation of ribosome-mediated translation of mRNA into a polypeptide.
biological process
    GO:0001731    formation of translation preinitiation complex    The joining of the small ribosomal subunit, ternary complex, and mRNA.
    GO:0045947    negative regulation of translational initiation    Any process that stops, prevents, or reduces the frequency, rate or extent of translational initiation.
    GO:0000184    nuclear-transcribed mRNA catabolic process, nonsense-mediated decay    The nonsense-mediated decay pathway for nuclear-transcribed mRNAs degrades mRNAs in which an amino-acid codon has changed to a nonsense codon; this prevents the translation of such mRNAs into truncated, and potentially harmful, proteins.
    GO:0006446    regulation of translational initiation    Any process that modulates the frequency, rate or extent of translational initiation.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
    GO:0006413    translational initiation    The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
cellular component
    GO:0016605    PML body    A class of nuclear body; they react against SP100 auto-antibodies (PML, promyelocytic leukemia); cells typically contain 10-30 PML bodies per nucleus; alterations in the localization of PML bodies occurs after viral infection.
    GO:0000785    chromatin    The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016282    eukaryotic 43S preinitiation complex    A protein complex composed of the 40S ribosomal subunit plus eIF1A, eIF3, and eIF2-GTP-bound methionyl-initiator methionine tRNA.
    GO:0033290    eukaryotic 48S preinitiation complex    A protein complex composed of the small ribosomal subunit, eIF3, eIF1A, methionyl-initiatior methionine and a capped mRNA. The complex is initially positioned at the 5'-end of the capped mRNA.
    GO:0005852    eukaryotic translation initiation factor 3 complex    A complex of several polypeptides that plays at least two important roles in protein synthesis: First, eIF3 binds to the 40S ribosome and facilitates loading of the Met-tRNA/eIF2.GTP ternary complex to form the 43S preinitiation complex. Subsequently, eIF3 apparently assists eIF4 in recruiting mRNAs to the 43S complex. The eIF3 complex contains five conserved core subunits, and may contain several additional proteins; the non-core subunits are thought to mediate association of the complex with specific sets of mRNAs.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain F   (EIF3F_HUMAN | O00303)
molecular function
    GO:0008234    cysteine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004843    thiol-dependent ubiquitin-specific protease activity    Catalysis of the thiol-dependent hydrolysis of a peptide bond formed by the C-terminal glycine of ubiquitin and another protein.
    GO:0036459    thiol-dependent ubiquitinyl hydrolase activity    Catalysis of the thiol-dependent hydrolysis of an ester, thioester, amide, peptide or isopeptide bond formed by the C-terminal glycine of ubiquitin.
    GO:0003743    translation initiation factor activity    Functions in the initiation of ribosome-mediated translation of mRNA into a polypeptide.
    GO:0031369    translation initiation factor binding    Interacting selectively and non-covalently with a translation initiation factor, any polypeptide factor involved in the initiation of ribosome-mediated translation.
biological process
    GO:0075522    IRES-dependent viral translational initiation    Process by which viral mRNA translation is initiated, where a domain in the 5' untranslated region (UTR) of the viral mRNA called an internal ribosome entry site (IRES) binds the host 43S preinitiation complex, circumventing regular cap-dependent translation initiation.
    GO:0001731    formation of translation preinitiation complex    The joining of the small ribosomal subunit, ternary complex, and mRNA.
    GO:0016579    protein deubiquitination    The removal of one or more ubiquitin groups from a protein.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0006446    regulation of translational initiation    Any process that modulates the frequency, rate or extent of translational initiation.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
    GO:0006413    translational initiation    The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016282    eukaryotic 43S preinitiation complex    A protein complex composed of the 40S ribosomal subunit plus eIF1A, eIF3, and eIF2-GTP-bound methionyl-initiator methionine tRNA.
    GO:0033290    eukaryotic 48S preinitiation complex    A protein complex composed of the small ribosomal subunit, eIF3, eIF1A, methionyl-initiatior methionine and a capped mRNA. The complex is initially positioned at the 5'-end of the capped mRNA.
    GO:0005852    eukaryotic translation initiation factor 3 complex    A complex of several polypeptides that plays at least two important roles in protein synthesis: First, eIF3 binds to the 40S ribosome and facilitates loading of the Met-tRNA/eIF2.GTP ternary complex to form the 43S preinitiation complex. Subsequently, eIF3 apparently assists eIF4 in recruiting mRNAs to the 43S complex. The eIF3 complex contains five conserved core subunits, and may contain several additional proteins; the non-core subunits are thought to mediate association of the complex with specific sets of mRNAs.
    GO:0071541    eukaryotic translation initiation factor 3 complex, eIF3m    An eukaryotic translation initiation factor 3 complex that contains the PCI-domain protein eIF3m.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain K   (EIF3K_HUMAN | Q9UBQ5)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043022    ribosome binding    Interacting selectively and non-covalently with any part of a ribosome.
    GO:0003743    translation initiation factor activity    Functions in the initiation of ribosome-mediated translation of mRNA into a polypeptide.
biological process
    GO:0001731    formation of translation preinitiation complex    The joining of the small ribosomal subunit, ternary complex, and mRNA.
    GO:0006446    regulation of translational initiation    Any process that modulates the frequency, rate or extent of translational initiation.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
    GO:0006413    translational initiation    The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016282    eukaryotic 43S preinitiation complex    A protein complex composed of the 40S ribosomal subunit plus eIF1A, eIF3, and eIF2-GTP-bound methionyl-initiator methionine tRNA.
    GO:0033290    eukaryotic 48S preinitiation complex    A protein complex composed of the small ribosomal subunit, eIF3, eIF1A, methionyl-initiatior methionine and a capped mRNA. The complex is initially positioned at the 5'-end of the capped mRNA.
    GO:0005852    eukaryotic translation initiation factor 3 complex    A complex of several polypeptides that plays at least two important roles in protein synthesis: First, eIF3 binds to the 40S ribosome and facilitates loading of the Met-tRNA/eIF2.GTP ternary complex to form the 43S preinitiation complex. Subsequently, eIF3 apparently assists eIF4 in recruiting mRNAs to the 43S complex. The eIF3 complex contains five conserved core subunits, and may contain several additional proteins; the non-core subunits are thought to mediate association of the complex with specific sets of mRNAs.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain L   (EIF3L_HUMAN | Q9Y262)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003743    translation initiation factor activity    Functions in the initiation of ribosome-mediated translation of mRNA into a polypeptide.
biological process
    GO:0001731    formation of translation preinitiation complex    The joining of the small ribosomal subunit, ternary complex, and mRNA.
    GO:0006446    regulation of translational initiation    Any process that modulates the frequency, rate or extent of translational initiation.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
    GO:0006413    translational initiation    The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
    GO:0075525    viral translational termination-reinitiation    A process which occurs as part of viral mRNA translation which allows expression of a downstream open reading frame (ORF) in a dicistronic mRNA. In this process, ribosomes translate the upstream ORF but following termination, a proportion of 40S subunits remain tethered to the mRNA and go on to re-initiate translation at the start codon of the downstream ORF.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016282    eukaryotic 43S preinitiation complex    A protein complex composed of the 40S ribosomal subunit plus eIF1A, eIF3, and eIF2-GTP-bound methionyl-initiator methionine tRNA.
    GO:0033290    eukaryotic 48S preinitiation complex    A protein complex composed of the small ribosomal subunit, eIF3, eIF1A, methionyl-initiatior methionine and a capped mRNA. The complex is initially positioned at the 5'-end of the capped mRNA.
    GO:0005852    eukaryotic translation initiation factor 3 complex    A complex of several polypeptides that plays at least two important roles in protein synthesis: First, eIF3 binds to the 40S ribosome and facilitates loading of the Met-tRNA/eIF2.GTP ternary complex to form the 43S preinitiation complex. Subsequently, eIF3 apparently assists eIF4 in recruiting mRNAs to the 43S complex. The eIF3 complex contains five conserved core subunits, and may contain several additional proteins; the non-core subunits are thought to mediate association of the complex with specific sets of mRNAs.
    GO:0001650    fibrillar center    A structure found most metazoan nucleoli, but not usually found in lower eukaryotes; surrounded by the dense fibrillar component; the zone of transcription from multiple copies of the pre-rRNA genes is in the border region between these two structures.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.

Chain M   (EIF3M_HUMAN | Q7L2H7)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003743    translation initiation factor activity    Functions in the initiation of ribosome-mediated translation of mRNA into a polypeptide.
    GO:0031369    translation initiation factor binding    Interacting selectively and non-covalently with a translation initiation factor, any polypeptide factor involved in the initiation of ribosome-mediated translation.
biological process
    GO:0002183    cytoplasmic translational initiation    The process preceding formation of the peptide bond between the first two amino acids of a protein in the cytoplasm. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
    GO:0001731    formation of translation preinitiation complex    The joining of the small ribosomal subunit, ternary complex, and mRNA.
    GO:0006446    regulation of translational initiation    Any process that modulates the frequency, rate or extent of translational initiation.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
    GO:0006413    translational initiation    The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016282    eukaryotic 43S preinitiation complex    A protein complex composed of the 40S ribosomal subunit plus eIF1A, eIF3, and eIF2-GTP-bound methionyl-initiator methionine tRNA.
    GO:0033290    eukaryotic 48S preinitiation complex    A protein complex composed of the small ribosomal subunit, eIF3, eIF1A, methionyl-initiatior methionine and a capped mRNA. The complex is initially positioned at the 5'-end of the capped mRNA.
    GO:0005852    eukaryotic translation initiation factor 3 complex    A complex of several polypeptides that plays at least two important roles in protein synthesis: First, eIF3 binds to the 40S ribosome and facilitates loading of the Met-tRNA/eIF2.GTP ternary complex to form the 43S preinitiation complex. Subsequently, eIF3 apparently assists eIF4 in recruiting mRNAs to the 43S complex. The eIF3 complex contains five conserved core subunits, and may contain several additional proteins; the non-core subunits are thought to mediate association of the complex with specific sets of mRNAs.
    GO:0071541    eukaryotic translation initiation factor 3 complex, eIF3m    An eukaryotic translation initiation factor 3 complex that contains the PCI-domain protein eIF3m.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    UNK  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3j8b)
 
  Cis Peptide Bonds
    Arg K:97 - Pro K:98   [ RasMol ]  
    Asn C:449 - Gln C:450   [ RasMol ]  
    Gln A:6 - Arg A:7   [ RasMol ]  
    Gly F:176 - His F:177   [ RasMol ]  
    Gly H:126 - Ser H:127   [ RasMol ]  
    His C:390 - Ala C:391   [ RasMol ]  
    Ile A:347 - Ile A:348   [ RasMol ]  
    Leu K:77 - Pro K:78   [ RasMol ]  
    Met A:306 - Arg A:307   [ RasMol ]  
    Met L:380 - Arg L:381   [ RasMol ]  
    Pro F:195 - Asn F:196   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3j8b
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  EIF3A_HUMAN | Q14152
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  EIF3C_HUMAN | Q99613
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  EIF3E_HUMAN | P60228
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  EIF3F_HUMAN | O00303
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  EIF3H_HUMAN | O15372
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  EIF3K_HUMAN | Q9UBQ5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  EIF3L_HUMAN | Q9Y262
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  EIF3M_HUMAN | Q7L2H7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.19.12
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  EIF3A_HUMAN | Q14152
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  EIF3C_HUMAN | Q99613
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  EIF3E_HUMAN | P60228
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  EIF3F_HUMAN | O00303
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  EIF3H_HUMAN | O15372
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  EIF3K_HUMAN | Q9UBQ5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  EIF3L_HUMAN | Q9Y262
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  EIF3M_HUMAN | Q7L2H7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        EIF3A_HUMAN | Q141523j8c
        EIF3C_HUMAN | Q996133j8c
        EIF3E_HUMAN | P602283j8c
        EIF3F_HUMAN | O003033j8c
        EIF3H_HUMAN | O153723j8c
        EIF3K_HUMAN | Q9UBQ51rz4 3j8c
        EIF3L_HUMAN | Q9Y2623j8c
        EIF3M_HUMAN | Q7L2H73j8c

(-) Related Entries Specified in the PDB File

1rz4 3chm 3j47 3j8c 4b4t 4lct 4o8x 4u1c 4u1d