3IZ1 - JenaLib

Asymmetric Unit (55, 165)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_002137	V	27	I	CXB2_HUMAN	Polymorphism	2274084	A/B/C	V	27	I
02	UniProt	VAR_023605	R	32	H	CXB2_HUMAN	Disease (DFNB1A)	111033190	A/B/C	R	32	H
03	UniProt	VAR_016839	R	32	L	CXB2_HUMAN	Polymorphism	111033190	A/B/C	R	32	L
04	UniProt	VAR_002138	M	34	T	CXB2_HUMAN	Unclassified	35887622	A/B/C	M	34	T
05	UniProt	VAR_002139	V	37	I	CXB2_HUMAN	Disease (DFNB1A)	72474224	A/B/C	V	37	I
06	UniProt	VAR_008709	W	44	C	CXB2_HUMAN	Disease (DFNA3A)	104894407	A/B/C	W	44	C
07	UniProt	VAR_032749	W	44	S	CXB2_HUMAN	Disease (DFNA3A)	104894413	A/B/C	W	44	S
08	UniProt	VAR_015455	G	45	E	CXB2_HUMAN	Polymorphism	72561723	A/B/C	G	45	E
09	UniProt	VAR_060798	D	46	E	CXB2_HUMAN	Disease (DFNA3A)	---	A/B/C	D	46	E
10	UniProt	VAR_015456	D	50	N	CXB2_HUMAN	Disease (KID syndrome)	28931594	A/B/C	D	50	N
11	UniProt	VAR_015935	D	50	Y	CXB2_HUMAN	Disease (KID syndrome)	28931594	A/B/C	D	50	Y
12	UniProt	VAR_032750	N	54	K	CXB2_HUMAN	Disease (BPS)	104894412	A/B/C	N	54	K
13	UniProt	VAR_009965	G	59	A	CXB2_HUMAN	Disease (PPKDFN)	104894404	A/B/C	G	59	A
14	UniProt	VAR_032751	G	59	S	CXB2_HUMAN	Disease (BPS)	104894410	A/B/C	G	59	S
15	UniProt	VAR_008710	D	66	H	CXB2_HUMAN	Disease (VOWNKL)	104894403	A/B/C	D	66	H
16	UniProt	VAR_015457	I	71	T	CXB2_HUMAN	Unclassified	---	A/B/C	I	71	T
17	UniProt	VAR_060799	H	73	R	CXB2_HUMAN	Disease (PPKDFN)	121912968	A/B/C	H	73	R
18	UniProt	VAR_015936	R	75	Q	CXB2_HUMAN	Disease (PPKDFN)	28931593	A/B/C	R	75	Q
19	UniProt	VAR_002140	R	75	W	CXB2_HUMAN	Disease (PPKDFN)	104894402	A/B/C	R	75	W
20	UniProt	VAR_002141	W	77	R	CXB2_HUMAN	Disease (DFNB1A)	104894397	A/B/C	W	77	R
21	UniProt	VAR_023607	L	79	P	CXB2_HUMAN	Disease (DFNB1A)	---	A/B/C	L	79	P
22	UniProt	VAR_023608	Q	80	K	CXB2_HUMAN	Disease (DFNB1A)	---	A/B/C	Q	80	K
23	UniProt	VAR_002142	F	83	L	CXB2_HUMAN	Polymorphism	111033218	A/B/C	F	83	L
24	UniProt	VAR_002143	V	84	L	CXB2_HUMAN	Disease (DFNB1A)	104894409	A/B/C	V	84	L
25	UniProt	VAR_060800	V	84	M	CXB2_HUMAN	Disease (DFNB1A)	104894409	A/B/C	V	84	M
26	UniProt	VAR_015458	T	86	R	CXB2_HUMAN	Disease (DFNB1A)	---	A/B/C	T	86	R
27	UniProt	VAR_015937	L	90	P	CXB2_HUMAN	Disease (DFNB1A)	80338945	A/B/C	L	90	P
28	UniProt	VAR_023609	M	93	I	CXB2_HUMAN	Disease (DFNB1A)	397516871	A/B/C	M	93	I
29	UniProt	VAR_002144	V	95	M	CXB2_HUMAN	Disease (DFNB1A)	111033299	A/B/C	V	95	M
30	UniProt	VAR_015939	R	127	H	CXB2_HUMAN	Polymorphism	111033196	A/B/C	R	127	H
31	UniProt	VAR_023611	E	129	K	CXB2_HUMAN	Disease (DFNB1A)	397516875	A/B/C	E	129	K
32	UniProt	VAR_069520	G	130	A	CXB2_HUMAN	Disease (DFNB1A)	---	A/B/C	G	130	A
33	UniProt	VAR_069521	G	130	D	CXB2_HUMAN	Disease (DFNB1A)	779018464	A/B/C	G	130	D
34	UniProt	VAR_069522	G	130	V	CXB2_HUMAN	Disease (VOWNKL)	---	A/B/C	G	130	V
35	UniProt	VAR_015940	R	143	Q	CXB2_HUMAN	Disease (DFNA3A)	104894401	A/B/C	R	143	Q
36	UniProt	VAR_015460	R	143	W	CXB2_HUMAN	Disease (DFNB1A)	80338948	A/B/C	R	143	W
37	UniProt	VAR_069524	A	148	P	CXB2_HUMAN	Polymorphism	---	A/B/C	A	148	P
38	UniProt	VAR_009967	V	153	I	CXB2_HUMAN	Polymorphism	111033186	A/B/C	V	153	I
39	UniProt	VAR_015941	D	159	V	CXB2_HUMAN	Disease (DFNB1A)	28931592	A/B/C	D	159	V
40	UniProt	VAR_002146	G	160	S	CXB2_HUMAN	Polymorphism	34988750	A/B/C	G	160	S
41	UniProt	VAR_015942	R	165	W	CXB2_HUMAN	Polymorphism	376898963	A/B/C	R	165	W
42	UniProt	VAR_023612	V	167	M	CXB2_HUMAN	Polymorphism	111033360	A/B/C	V	167	M
43	UniProt	VAR_057959	K	168	R	CXB2_HUMAN	Unclassified	200104362	A/B/C	K	168	R
44	UniProt	VAR_009968	C	169	Y	CXB2_HUMAN	Polymorphism	774518779	A/B/C	C	169	Y
45	UniProt	VAR_023613	V	178	A	CXB2_HUMAN	Disease (DFNB1A)	568612627	A/B/C	V	178	A
46	UniProt	VAR_032752	D	179	N	CXB2_HUMAN	Disease (DFNA3A)	28931595	A/B/C	D	179	N
47	UniProt	VAR_015943	R	184	P	CXB2_HUMAN	Disease (DFNB1A)	80338950	A/B/C	R	184	P
48	UniProt	VAR_023614	R	184	Q	CXB2_HUMAN	Disease (DFNA3A)	80338950	A/B/C	R	184	Q
49	UniProt	VAR_009969	R	184	W	CXB2_HUMAN	Disease (DFNB1A)	---	A/B/C	R	184	W
50	UniProt	VAR_015461	F	191	L	CXB2_HUMAN	Polymorphism	397516878	A/B/C	F	191	L
51	UniProt	VAR_023615	A	197	S	CXB2_HUMAN	Disease (DFNA3A)	---	A/B/C	A	197	S
52	UniProt	VAR_015944	C	202	F	CXB2_HUMAN	Disease (DFNA3A)	104894406	A/B/C	C	202	F
53	UniProt	VAR_023616	I	203	K	CXB2_HUMAN	Disease (DFNB1A)	---	A/B/C	I	203	K
54	UniProt	VAR_009970	I	203	T	CXB2_HUMAN	Polymorphism	76838169	A/B/C	I	203	T
55	UniProt	VAR_023617	L	214	P	CXB2_HUMAN	Disease (DFNB1A)	---	A/B/C	L	214	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (55, 330)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_002137	V	27	I	CXB2_HUMAN	Polymorphism	2274084	A/B/C	V	27	I
02	UniProt	VAR_023605	R	32	H	CXB2_HUMAN	Disease (DFNB1A)	111033190	A/B/C	R	32	H
03	UniProt	VAR_016839	R	32	L	CXB2_HUMAN	Polymorphism	111033190	A/B/C	R	32	L
04	UniProt	VAR_002138	M	34	T	CXB2_HUMAN	Unclassified	35887622	A/B/C	M	34	T
05	UniProt	VAR_002139	V	37	I	CXB2_HUMAN	Disease (DFNB1A)	72474224	A/B/C	V	37	I
06	UniProt	VAR_008709	W	44	C	CXB2_HUMAN	Disease (DFNA3A)	104894407	A/B/C	W	44	C
07	UniProt	VAR_032749	W	44	S	CXB2_HUMAN	Disease (DFNA3A)	104894413	A/B/C	W	44	S
08	UniProt	VAR_015455	G	45	E	CXB2_HUMAN	Polymorphism	72561723	A/B/C	G	45	E
09	UniProt	VAR_060798	D	46	E	CXB2_HUMAN	Disease (DFNA3A)	---	A/B/C	D	46	E
10	UniProt	VAR_015456	D	50	N	CXB2_HUMAN	Disease (KID syndrome)	28931594	A/B/C	D	50	N
11	UniProt	VAR_015935	D	50	Y	CXB2_HUMAN	Disease (KID syndrome)	28931594	A/B/C	D	50	Y
12	UniProt	VAR_032750	N	54	K	CXB2_HUMAN	Disease (BPS)	104894412	A/B/C	N	54	K
13	UniProt	VAR_009965	G	59	A	CXB2_HUMAN	Disease (PPKDFN)	104894404	A/B/C	G	59	A
14	UniProt	VAR_032751	G	59	S	CXB2_HUMAN	Disease (BPS)	104894410	A/B/C	G	59	S
15	UniProt	VAR_008710	D	66	H	CXB2_HUMAN	Disease (VOWNKL)	104894403	A/B/C	D	66	H
16	UniProt	VAR_015457	I	71	T	CXB2_HUMAN	Unclassified	---	A/B/C	I	71	T
17	UniProt	VAR_060799	H	73	R	CXB2_HUMAN	Disease (PPKDFN)	121912968	A/B/C	H	73	R
18	UniProt	VAR_015936	R	75	Q	CXB2_HUMAN	Disease (PPKDFN)	28931593	A/B/C	R	75	Q
19	UniProt	VAR_002140	R	75	W	CXB2_HUMAN	Disease (PPKDFN)	104894402	A/B/C	R	75	W
20	UniProt	VAR_002141	W	77	R	CXB2_HUMAN	Disease (DFNB1A)	104894397	A/B/C	W	77	R
21	UniProt	VAR_023607	L	79	P	CXB2_HUMAN	Disease (DFNB1A)	---	A/B/C	L	79	P
22	UniProt	VAR_023608	Q	80	K	CXB2_HUMAN	Disease (DFNB1A)	---	A/B/C	Q	80	K
23	UniProt	VAR_002142	F	83	L	CXB2_HUMAN	Polymorphism	111033218	A/B/C	F	83	L
24	UniProt	VAR_002143	V	84	L	CXB2_HUMAN	Disease (DFNB1A)	104894409	A/B/C	V	84	L
25	UniProt	VAR_060800	V	84	M	CXB2_HUMAN	Disease (DFNB1A)	104894409	A/B/C	V	84	M
26	UniProt	VAR_015458	T	86	R	CXB2_HUMAN	Disease (DFNB1A)	---	A/B/C	T	86	R
27	UniProt	VAR_015937	L	90	P	CXB2_HUMAN	Disease (DFNB1A)	80338945	A/B/C	L	90	P
28	UniProt	VAR_023609	M	93	I	CXB2_HUMAN	Disease (DFNB1A)	397516871	A/B/C	M	93	I
29	UniProt	VAR_002144	V	95	M	CXB2_HUMAN	Disease (DFNB1A)	111033299	A/B/C	V	95	M
30	UniProt	VAR_015939	R	127	H	CXB2_HUMAN	Polymorphism	111033196	A/B/C	R	127	H
31	UniProt	VAR_023611	E	129	K	CXB2_HUMAN	Disease (DFNB1A)	397516875	A/B/C	E	129	K
32	UniProt	VAR_069520	G	130	A	CXB2_HUMAN	Disease (DFNB1A)	---	A/B/C	G	130	A
33	UniProt	VAR_069521	G	130	D	CXB2_HUMAN	Disease (DFNB1A)	779018464	A/B/C	G	130	D
34	UniProt	VAR_069522	G	130	V	CXB2_HUMAN	Disease (VOWNKL)	---	A/B/C	G	130	V
35	UniProt	VAR_015940	R	143	Q	CXB2_HUMAN	Disease (DFNA3A)	104894401	A/B/C	R	143	Q
36	UniProt	VAR_015460	R	143	W	CXB2_HUMAN	Disease (DFNB1A)	80338948	A/B/C	R	143	W
37	UniProt	VAR_069524	A	148	P	CXB2_HUMAN	Polymorphism	---	A/B/C	A	148	P
38	UniProt	VAR_009967	V	153	I	CXB2_HUMAN	Polymorphism	111033186	A/B/C	V	153	I
39	UniProt	VAR_015941	D	159	V	CXB2_HUMAN	Disease (DFNB1A)	28931592	A/B/C	D	159	V
40	UniProt	VAR_002146	G	160	S	CXB2_HUMAN	Polymorphism	34988750	A/B/C	G	160	S
41	UniProt	VAR_015942	R	165	W	CXB2_HUMAN	Polymorphism	376898963	A/B/C	R	165	W
42	UniProt	VAR_023612	V	167	M	CXB2_HUMAN	Polymorphism	111033360	A/B/C	V	167	M
43	UniProt	VAR_057959	K	168	R	CXB2_HUMAN	Unclassified	200104362	A/B/C	K	168	R
44	UniProt	VAR_009968	C	169	Y	CXB2_HUMAN	Polymorphism	774518779	A/B/C	C	169	Y
45	UniProt	VAR_023613	V	178	A	CXB2_HUMAN	Disease (DFNB1A)	568612627	A/B/C	V	178	A
46	UniProt	VAR_032752	D	179	N	CXB2_HUMAN	Disease (DFNA3A)	28931595	A/B/C	D	179	N
47	UniProt	VAR_015943	R	184	P	CXB2_HUMAN	Disease (DFNB1A)	80338950	A/B/C	R	184	P
48	UniProt	VAR_023614	R	184	Q	CXB2_HUMAN	Disease (DFNA3A)	80338950	A/B/C	R	184	Q
49	UniProt	VAR_009969	R	184	W	CXB2_HUMAN	Disease (DFNB1A)	---	A/B/C	R	184	W
50	UniProt	VAR_015461	F	191	L	CXB2_HUMAN	Polymorphism	397516878	A/B/C	F	191	L
51	UniProt	VAR_023615	A	197	S	CXB2_HUMAN	Disease (DFNA3A)	---	A/B/C	A	197	S
52	UniProt	VAR_015944	C	202	F	CXB2_HUMAN	Disease (DFNA3A)	104894406	A/B/C	C	202	F
53	UniProt	VAR_023616	I	203	K	CXB2_HUMAN	Disease (DFNB1A)	---	A/B/C	I	203	K
54	UniProt	VAR_009970	I	203	T	CXB2_HUMAN	Polymorphism	76838169	A/B/C	I	203	T
55	UniProt	VAR_023617	L	214	P	CXB2_HUMAN	Disease (DFNB1A)	---	A/B/C	L	214	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (2, 6)

Exons (1, 3)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:185
 aligned with CXB2_HUMAN | P29033 from UniProtKB/Swiss-Prot  Length:226

    Alignment length:200
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217
           CXB2_HUMAN    18 TSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDGFSMQRLVKCNAWPCPNTVDCFVSRPTEKTVFTVFMIAVSGICILLNVTELCYLLIRY 217
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............................................................................................---------------............................................................................................. Sec.struct. author
             SAPs(SNPs) (1) ---------I----H-T--I------CEE---N---K----A------H----T-R-Q-R-PK--LL-R---P--I-M-------------------------------H-KA------------Q----P----I-----VS----W-MRY--------AN----P------L-----S----FK----------P--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------L-----------S-----Y--------S---------------W--------M---------------------------------------------D------------W----------------------------------------Q------------------T-------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ----------------------------------------------------------------------------------------------------------------V-----------------------------------------------------W--------------------------------- SAPs(SNPs) (3)
                    PROSITE -----------------------------------CONNEXINS_1   ------------------------------------------------------------------------------------------------------CONNEXINS_2      -------------------------------- PROSITE
               Transcript 1 Exon 1.2b  PDB: A:18-217 (gaps) UniProt: 1-234 [INCOMPLETE]                                                                                                                                              Transcript 1
                 3iz1 A  18 TSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEKKRKFIKG---------------KVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDGFSMQRLVKCNAWPCPNTVDCFVSRPTEKTVFTVFMIAVSGICILLNVTELCYLLIRY 217
                                    27        37        47        57        67        77        87        97       107 |       -       127       137       147       157       167       177       187       197       207       217
                                                                                                                     109             125

Chain B from PDB  Type:PROTEIN  Length:185
 aligned with CXB2_HUMAN | P29033 from UniProtKB/Swiss-Prot  Length:226

    Alignment length:200
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217
           CXB2_HUMAN    18 TSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDGFSMQRLVKCNAWPCPNTVDCFVSRPTEKTVFTVFMIAVSGICILLNVTELCYLLIRY 217
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............................................................................................---------------............................................................................................. Sec.struct. author
             SAPs(SNPs) (1) ---------I----H-T--I------CEE---N---K----A------H----T-R-Q-R-PK--LL-R---P--I-M-------------------------------H-KA------------Q----P----I-----VS----W-MRY--------AN----P------L-----S----FK----------P--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------L-----------S-----Y--------S---------------W--------M---------------------------------------------D------------W----------------------------------------Q------------------T-------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ----------------------------------------------------------------------------------------------------------------V-----------------------------------------------------W--------------------------------- SAPs(SNPs) (3)
                    PROSITE -----------------------------------CONNEXINS_1   ------------------------------------------------------------------------------------------------------CONNEXINS_2      -------------------------------- PROSITE
               Transcript 1 Exon 1.2b  PDB: B:18-217 (gaps) UniProt: 1-234 [INCOMPLETE]                                                                                                                                              Transcript 1
                 3iz1 B  18 TSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEKKRKFIKG---------------KVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDGFSMQRLVKCNAWPCPNTVDCFVSRPTEKTVFTVFMIAVSGICILLNVTELCYLLIRY 217
                                    27        37        47        57        67        77        87        97       107 |       -       127       137       147       157       167       177       187       197       207       217
                                                                                                                     109             125

Chain C from PDB  Type:PROTEIN  Length:185
 aligned with CXB2_HUMAN | P29033 from UniProtKB/Swiss-Prot  Length:226

    Alignment length:200
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217
           CXB2_HUMAN    18 TSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDGFSMQRLVKCNAWPCPNTVDCFVSRPTEKTVFTVFMIAVSGICILLNVTELCYLLIRY 217
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............................................................................................---------------............................................................................................. Sec.struct. author
             SAPs(SNPs) (1) ---------I----H-T--I------CEE---N---K----A------H----T-R-Q-R-PK--LL-R---P--I-M-------------------------------H-KA------------Q----P----I-----VS----W-MRY--------AN----P------L-----S----FK----------P--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------L-----------S-----Y--------S---------------W--------M---------------------------------------------D------------W----------------------------------------Q------------------T-------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ----------------------------------------------------------------------------------------------------------------V-----------------------------------------------------W--------------------------------- SAPs(SNPs) (3)
                    PROSITE -----------------------------------CONNEXINS_1   ------------------------------------------------------------------------------------------------------CONNEXINS_2      -------------------------------- PROSITE
               Transcript 1 Exon 1.2b  PDB: C:18-217 (gaps) UniProt: 1-234 [INCOMPLETE]                                                                                                                                              Transcript 1
                 3iz1 C  18 TSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEKKRKFIKG---------------KVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDGFSMQRLVKCNAWPCPNTVDCFVSRPTEKTVFTVFMIAVSGICILLNVTELCYLLIRY 217
                                    27        37        47        57        67        77        87        97       107 |       -       127       137       147       157       167       177       187       197       207       217
                                                                                                                     109             125

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (23, 23)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C (CXB2_HUMAN | P29033)

molecular function
	GO:0005243	gap junction channel activity	A wide pore channel activity that enables a direct cytoplasmic connection from one cell to an adjacent cell. The gap junction can pass large solutes as well as electrical signals between cells. Gap junctions consist of two gap junction hemi-channels, or connexons, one contributed by each membrane through which the gap junction passes.
biological process
	GO:0007154	cell communication	Any process that mediates interactions between a cell and its surroundings. Encompasses interactions such as signaling or attachment between one cell and another cell, between a cell and an extracellular matrix, or between a cell and any other aspect of its environment.
	GO:0007267	cell-cell signaling	Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
	GO:0034599	cellular response to oxidative stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
	GO:0046697	decidualization	The cellular and vascular changes occurring in the endometrium of the pregnant uterus just after the onset of blastocyst implantation. This process involves the proliferation and differentiation of the fibroblast-like endometrial stromal cells into large, polyploid decidual cells that eventually form the maternal component of the placenta.
	GO:0007565	female pregnancy	The set of physiological processes that allow an embryo or foetus to develop within the body of a female animal. It covers the time from fertilization of a female ovum by a male spermatozoon until birth.
	GO:0016264	gap junction assembly	Assembly of gap junctions, which are found in most animal tissues, and serve as direct connections between the cytoplasms of adjacent cells. They provide open channels through the plasma membrane, allowing ions and small molecules (less than approximately a thousand daltons) to diffuse freely between neighboring cells, but preventing the passage of proteins and nucleic acids.
	GO:0030539	male genitalia development	The process whose specific outcome is the progression of the male genitalia over time, from its formation to the mature structure.
	GO:0032355	response to estradiol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
	GO:0044752	response to human chorionic gonadotropin	Any process that results in a change in state or activity of a cell or organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a human chorionic gonadotropin stimulus.
	GO:0032570	response to progesterone	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a progesterone stimulus.
	GO:0007605	sensory perception of sound	The series of events required for an organism to receive an auditory stimulus, convert it to a molecular signal, and recognize and characterize the signal. Sonic stimuli are detected in the form of vibrations and are processed to form a sound.
	GO:0055085	transmembrane transport	The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0005922	connexin complex	An assembly of six molecules of connexin, made in the Golgi apparatus and subsequently transported to the plasma membrane, where docking of two connexons on apposed plasma membranes across the extracellular space forms a gap junction.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	A complex system of membrane-bounded compartments located between endoplasmic reticulum (ER) and the Golgi complex, with a distinctive membrane protein composition; involved in ER-to-Golgi and Golgi-to-ER transport.
	GO:0005921	gap junction	A cell-cell junction composed of pannexins or innexins and connexins, two different families of channel-forming proteins.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016328	lateral plasma membrane	The portion of the plasma membrane at the lateral side of the cell. In epithelial cells, lateral plasma membranes are on the sides of cells which lie at the interface of adjacent cells.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (55, 165)

PROSITE Motifs (2, 6)

Exons (1, 3)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (23, 23)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File