3IR4 - JenaLib

Title :   1.2 ANGSTROM CRYSTAL STRUCTURE OF THE GLUTAREDOXIN 2 (GRXB) FROM SALMONELLA TYPHIMURIUM IN COMPLEX WITH GLUTATHIONE

Authors :   G. Minasov, Z. Wawrzak, T. Skarina, O. Onopriyenko, S. N. Peterson, A. H Z. Dauter, W. F. Anderson, Center For Structural Genomics Of Inf Diseases (Csgid)

Date :   21 Aug 09 (Deposition) - 01 Sep 09 (Release) - 21 Dec 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.20

Chains :   Asym./Biol. Unit : A

Keywords :   Glutaredoxin 2, Glutathione, Idp00895, Structural Genomics, Center For Structural Genomics Of Infectious Diseases, Csgid, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   G. Minasov, Z. Wawrzak, T. Skarina, O. Onopriyenko, S. N. Peterson, A. Halavaty, Z. Dauter, W. F. Anderson, Center For Structural Genomics Of Infectious Diseases (Csgid)
1. 2 Angstrom Crystal Structure Of The Glutaredoxin 2 (Grxb) From Salmonella Typhimurium In Complex With Glutathione.
To Be Published
PubMed: search

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 12)

Sites (5, 5)

Asymmetric Unit (5, 5)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	TYR A:6 , CYS A:9 , PHE A:11 , LYS A:46 , MSE A:47 , VAL A:48 , PRO A:49 , GLU A:61 , SER A:62 , LYS A:125 , HOH A:236 , HOH A:258 , HOH A:347 , HOH A:371 , HOH A:387 , HOH A:445 , HOH A:499 , HOH A:527 , HOH A:603 , HOH A:661 , HOH A:705	BINDING SITE FOR RESIDUE GSH A 216
2	AC2	SOFTWARE	LYS A:14	BINDING SITE FOR RESIDUE CL A 217
3	AC3	SOFTWARE	LYS A:53 , ASP A:55 , ARG A:57 , TYR A:68 , HOH A:314 , HOH A:579 , HOH A:622 , HOH A:672	BINDING SITE FOR RESIDUE SO4 A 218
4	AC4	SOFTWARE	ARG A:152 , ASN A:162 , HIS A:189 , GLN A:204 , HOH A:240 , HOH A:249 , HOH A:414 , HOH A:418 , HOH A:489 , HOH A:589	BINDING SITE FOR RESIDUE SO4 A 219
5	AC5	SOFTWARE	ARG A:82 , HIS A:174 , HOH A:352 , HOH A:442 , HOH A:606 , HOH A:694	BINDING SITE FOR RESIDUE SO4 A 220

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:218
 aligned with Q7CQR3_SALTY | Q7CQR3 from UniProtKB/TrEMBL  Length:215

    Alignment length:218
                               1                                                                                                                                                                                                                        
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207        
         Q7CQR3_SALTY     - ---MKLYIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDDSRYLPESMDIVHYVDNLDGKPLLTGKRNPAIEEWLRKVNGYVNQLLLPRFAKSAFDEFSTPAARQYFIRKKEASSGSFDNHLAHSAGLIKKIGDDLRLLDKLIVQPNAVNGELSEDDIHLFPLLRNLTLVAGIHWPTKVADYRDNMAKQTQINLLSSMAI 215
               SCOP domains d3ir4a1 A:-2-75 automated matches                                             d3ir4a2 A:76-215 automated matches                                                                                                           SCOP domains
               CATH domains ----------3ir4A01 A:8-85 Glutaredoxin                                                   ----3ir4A02 A:90-215  [code=1.20.1050.10, no name defined]                                                                         CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee...hhhhhhhhhhhhhhh...eeee.....hhhhhhhhh.....eee.....eeehhhhhhhhhhhh..........hhhhhhhhhhhhh.hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh...hhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ir4 A  -2 SNAmKLYIYDHCPFCVKARmIFGLKNIPVELNVLQNDDEATPTRmIGQKmVPILQKDDSRYLPESmDIVHYVDNLDGKPLLTGKRNPAIEEWLRKVNGYVNQLLLPRFAKSAFDEFSTPAARQYFIRKKEASSGSFDNHLAHSAGLIKKIGDDLRLLDKLIVQPNAVNGELSEDDIHLFPLLRNLTLVAGIHWPTKVADYRDNmAKQTQINLLSSmAI 215
                               |     7        17        27        37    |   47        57     |  67        77        87        97       107       117       127       137       147       157       167       177       187       197   |   207     |  
                               |              17-MSE                   42-MSE|              63-MSE                                                                                                                                   201-MSE     213-MSE
                               1-MSE                                        47-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (2, 2)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (Q7CQR3_SALTY | Q7CQR3)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0015038	glutathione disulfide oxidoreductase activity	Catalysis of the reaction: 2 glutathione + electron acceptor = glutathione disulfide + electron donor.
	GO:0004364	glutathione transferase activity	Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
	GO:0015035	protein disulfide oxidoreductase activity	Catalysis of the reaction: a protein with reduced sulfide groups = a protein with oxidized disulfide bonds.
biological process
	GO:0045454	cell redox homeostasis	Any process that maintains the redox environment of a cell or compartment within a cell.
	GO:0006749	glutathione metabolic process	The chemical reactions and pathways involving glutathione, the tripeptide glutamylcysteinylglycine, which acts as a coenzyme for some enzymes and as an antioxidant in the protection of sulfhydryl groups in enzymes and other proteins; it has a specific role in the reduction of hydrogen peroxide (H2O2) and oxidized ascorbate, and it participates in the gamma-glutamyl cycle.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GSH	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Val A:48 - Pro A:49	[ RasMol ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	3ir4
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q7CQR3_SALTY \| Q7CQR3
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description