Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE NANOARCHAEUM EQUITANS TRNA SPLICING ENDONUCLEASE STRUCTURAL SUBUNIT
 
Authors :  M. Mitchell, H. Li
Date :  23 Jul 09  (Deposition) - 18 Aug 09  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  X
Biol. Unit 1:  X  (2x)
Keywords :  Protein, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Mitchell, S. Xue, R. Erdman, L. Randau, D. Soll, H. Li
Crystal Structure And Assembly Of The Functional Nanoarchaeum Equitans Trna Splicing Endonuclease.
Nucleic Acids Res. V. 37 5793 2009
PubMed-ID: 19578064  |  Reference-DOI: 10.1093/NAR/GKP537

(-) Compounds

Molecule 1 - NEQ261
    ChainsX
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28A
    Expression System StrainBL21
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneNEQ261
    Organism ScientificNANOARCHAEUM EQUITANS
    Organism Taxid160232

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit X
Biological Unit 1 (2x)X

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3IF0)

(-) Sites  (0, 0)

(no "Site" information available for 3IF0)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3IF0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3IF0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3IF0)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3IF0)

(-) Exons   (0, 0)

(no "Exon" information available for 3IF0)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain X from PDB  Type:PROTEIN  Length:149
 aligned with Q74MS9_NANEQ | Q74MS9 from UniProtKB/TrEMBL  Length:153

    Alignment length:149
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140         
         Q74MS9_NANEQ     1 MNLRIPWKEVYYLGYNMGNYIKISEPELLFVLRNKPQIKDRLKLDEKTIIKEGVKKYKNFWEIYYTVKDLILRGYRVRFDGFFIELYEKGIIPGTIEQDYLVYPVSGEIRMTWGELLDIYNKAIARKSKFMLAIVDSEGDVTYYEFRKL 149
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee..hhhhhh...ee....ee.hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh.hhhhhhhhhhhhhhh..eeee....eeee............eeeeeee.....hhhhhhhhhhhhhhh..eeeeeee.....eeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3if0 X   1 MNLRIPWKEVYYLGYNMGNYIKISEPELLFVLRNKPQIKDRLKLDEKTIIKEGVKKYKNFWEIYYTVKDLILRGYRVRFDGFFIELYEKGIIPGTIEQDYLVYPVSGEIRMTWGELLDIYNKAIARKSKFMLAIVDSEGDVTYYEFRKL 149
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3IF0)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3IF0)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3IF0)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)
Chain X   (Q74MS9_NANEQ | Q74MS9)
molecular function
    GO:0004518    nuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0000213    tRNA-intron endonuclease activity    Catalysis of the endonucleolytic cleavage of pre-tRNA, producing 5'-hydroxyl and 2',3'-cyclic phosphate termini, and specifically removing the intron.
biological process
    GO:0090501    RNA phosphodiester bond hydrolysis    The RNA metabolic process in which the phosphodiester bonds between ribonucleotides are cleaved by hydrolysis.
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0090305    nucleic acid phosphodiester bond hydrolysis    The nucleic acid metabolic process in which the phosphodiester bonds between nucleotides are cleaved by hydrolysis.
    GO:0006388    tRNA splicing, via endonucleolytic cleavage and ligation    Splicing of tRNA substrates via recognition of the folded RNA structure that brings the 5' and 3' splice sites into proximity and cleavage of the RNA at both the 3' and 5' splice sites by an endonucleolytic mechanism, followed by ligation of the exons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3if0)
 
  Sites
(no "Sites" information available for 3if0)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3if0)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3if0
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q74MS9_NANEQ | Q74MS9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q74MS9_NANEQ | Q74MS9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q74MS9_NANEQ | Q74MS93iey

(-) Related Entries Specified in the PDB File

3iey NANOARCHAEUM EQUITANS TRNA SPLICING ENDONUCLEASE