Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE ACT DOMAIN FROM GTP PYROPHOSPHOKINASE OF CHLOROBIUM TEPIDUM. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET CTR148A
 
Authors :  S. Vorobiev, M. Su, J. Seetharaman, J. Janjua, R. Xiao, C. Ciccosanti, H. Wang, J. K. Everett, R. Nair, T. B. Acton, B. Rost, G. T. Montelione, L. Tong, J. F. Hunt, Northeast Structural Genomics Consortium (Nesg)
Date :  17 Jul 09  (Deposition) - 28 Jul 09  (Release) - 28 Jul 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.93
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Gtp Pyrophosphokinase, Act Domain, Kinase, Transferase, Nesg, Ctr148A, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Vorobiev, M. Su, J. Seetharaman, J. Janjua, R. Xiao, C. Ciccosanti, H. Wang, J. K. Everett, R. Nair, T. B. Acton, B. Rost, G. T. Montelione, L. Tong, J. F. Hunt
Crystal Structure Of The Act Domain From Gtp Pyrophosphokinase Of Chlorobium Tepidum.
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GTP PYROPHOSPHOKINASE
    Chains: A, B
    EC Number: 2.7.6.5
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET 21-23C
    Expression System Strain: BL21(DE3)+ MAGIC
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: ACT DOMAIN
    Gene: CT1545, RELA
    Mutation: YES
    Organism Scientific: CHLOROBACULUM TEPIDUM
    Organism Taxid: 1097
    Strain: ATCC 49652/DSM 12025/TLS

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 6)

Asymmetric/Biological Unit (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3IBW)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3IBW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3IBW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3IBW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3IBW)

(-) Exons   (0, 0)

(no "Exon" information available for 3IBW)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:79
 aligned with Q8KC80_CHLTE | Q8KC80 from UniProtKB/TrEMBL  Length:731

    Alignment length:79
                                   662       672       682       692       702       712       722         
         Q8KC80_CHLTE   653 TDFLAGIRIVGEDKIGMTNQITGVISKFDTNIRTIVLNAKDGIFTCNLMIFVKNTDKLTTLMDKLRKVQGVFTVERLSN 731
               SCOP domains ------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeee...hhhhhhhhhhhhh..eeeeeeeeee..eeeeeeeeee.hhhhhhhhhhhhhh...eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------- Transcript
                 3ibw A 653 TDFLAGIRIVGEDKNGmTNQITGVISKFDTNIRTIVLNAKDGIFTCNLmIFVKNTDKLTTLmDKLRKVQGVFTVERLSN 731
                                   662      |672       682       692       702       712 |     722         
                                          669-MSE                         701-MSE      714-MSE             


Chain B from PDB  Type:PROTEIN  Length:77
 aligned with Q8KC80_CHLTE | Q8KC80 from UniProtKB/TrEMBL  Length:731

    Alignment length:77
                                   662       672       682       692       702       712       722       
         Q8KC80_CHLTE   653 TDFLAGIRIVGEDKIGMTNQITGVISKFDTNIRTIVLNAKDGIFTCNLMIFVKNTDKLTTLMDKLRKVQGVFTVERL 729
               SCOP domains ----------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeee...hhhhhhhhhhhhh..eeeeeeeeee..eeeeeeeeee.hhhhhhhhhhhhhh...eeeeeee Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------- Transcript
                 3ibw B 653 TDFLAGIRIVGEDKNGmTNQITGVISKFDTNIRTIVLNAKDGIFTCNLmIFVKNTDKLTTLmDKLRKVQGVFTVERL 729
                                   662      |672       682       692       702       712 |     722       
                                          669-MSE                         701-MSE      714-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3IBW)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3IBW)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3IBW)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q8KC80_CHLTE | Q8KC80)
molecular function
    GO:0008728    GTP diphosphokinase activity    Catalysis of the reaction: ATP + GTP = AMP + guanosine 3'-diphosphate 5'-triphosphate.
    GO:0016597    amino acid binding    Interacting selectively and non-covalently with an amino acid, organic acids containing one or more amino substituents.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0015969    guanosine tetraphosphate metabolic process    The chemical reactions and pathways involving guanine tetraphosphate (5'-ppGpp-3'), a derivative of guanine riboside with four phosphates.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3ibw)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3ibw)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3ibw
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8KC80_CHLTE | Q8KC80
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.7.6.5
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8KC80_CHLTE | Q8KC80
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8KC80_CHLTE | Q8KC80: 2ko1

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3IBW)