Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF AN UNCHARACTERIZED PROTEIN FROM LISTERIA MONOCYTOGENES SEROTYPE 4B
 
Authors :  J. B. Bonanno, M. Gilmore, K. T. Bain, J. Do, S. Ozyurt, J. M. Sauder, S. K. S. C. Almo, New York Sgx Research Center For Structural Genomi (Nysgxrc)
Date :  15 Jul 09  (Deposition) - 28 Jul 09  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Structural Genomics, Unknown Function, Psi-2, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. B. Bonanno, M. Gilmore, K. T. Bain, J. Do, S. Ozyurt, J. M. Sauder, S. K. Burley, S. C. Almo
Crystal Structure Of An Uncharacterized Protein From Listeria Monocytogenes Serotype 4B
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - UNCHARACTERIZED PROTEIN
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: MODIFIED PET26
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PET
    Gene: LM4B_00283
    Organism Scientific: LISTERIA MONOCYTOGENES
    Organism Taxid: 634178
    Strain: CLIP81459

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3IB6)

(-) Sites  (0, 0)

(no "Site" information available for 3IB6)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3IB6)

(-) Cis Peptide Bonds  (12, 12)

Asymmetric/Biological Unit
No.Residues
1Lys A:96 -Pro A:97
2Ala A:156 -Pro A:157
3Pro A:157 -Pro A:158
4Lys B:96 -Pro B:97
5Ala B:156 -Pro B:157
6Pro B:157 -Pro B:158
7Lys C:96 -Pro C:97
8Ala C:156 -Pro C:157
9Pro C:157 -Pro C:158
10Lys D:96 -Pro D:97
11Ala D:156 -Pro D:157
12Pro D:157 -Pro D:158

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3IB6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3IB6)

(-) Exons   (0, 0)

(no "Exon" information available for 3IB6)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:179
                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.................hhhhh.......hhhhhhhhhhhh..eeeeee.....hhhhhhhhhhhh.hhh.eeeeee.............hhhhhhhhhhhhh.hhh.eeeee.....hhhhhhhh..eeeee...................eeee.hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ib6 A   2 LTHVIWDMGETLNTVPNTRYDHHPLDTYPEVVLRKNAKETLEKVKQLGFKQAILSNTATSDTEVIKRVLTNFGIIDYFDFIYASNSELQPGKMEKPDKTIFDFTLNALQIDKTEAVMVGNTFESDIIGANRAGIHAIWLQNPEVCLQDERLPLVAPPFVIPVWDLADVPEALLLLKKIS 180
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171         


Chain B from PDB  Type:PROTEIN  Length:179
                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.................hhhhh.......hhhhhhhhhhhh..eeeeee.....hhhhhhhhhhhh.hhh.eeeeee.............hhhhhhhhhhhhh.hhh.eeeee.....hhhhhhhh..eeeee...................eeee.hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ib6 B   2 LTHVIWDMGETLNTVPNTRYDHHPLDTYPEVVLRKNAKETLEKVKQLGFKQAILSNTATSDTEVIKRVLTNFGIIDYFDFIYASNSELQPGKMEKPDKTIFDFTLNALQIDKTEAVMVGNTFESDIIGANRAGIHAIWLQNPEVCLQDERLPLVAPPFVIPVWDLADVPEALLLLKKIS 180
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171         


Chain C from PDB  Type:PROTEIN  Length:178
                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.................hhhhh.......hhhhhhhhhhhhh.eeeeee.....hhhhhhhhhhhh.hhh.eeeeee.............hhhhhhhhhhhhh.hhh.eeeee.....hhhhhhhh..eeeee...................eeee.hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ib6 C   2 LTHVIWDMGETLNTVPNTRYDHHPLDTYPEVVLRKNAKETLEKVKQLGFKQAILSNTATSDTEVIKRVLTNFGIIDYFDFIYASNSELQPGKMEKPDKTIFDFTLNALQIDKTEAVMVGNTFESDIIGANRAGIHAIWLQNPEVCLQDERLPLVAPPFVIPVWDLADVPEALLLLKKI 179
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171        


Chain D from PDB  Type:PROTEIN  Length:179
                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.................hhhhh.......hhhhhhhhhhhh..eeeeee.....hhhhhhhhhhhh.hhh.eeeeee.............hhhhhhhhhhhhh.hhh.eeeee....hhhhhhhhh..eeeee...................eeee.hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ib6 D   2 LTHVIWDMGETLNTVPNTRYDHHPLDTYPEVVLRKNAKETLEKVKQLGFKQAILSNTATSDTEVIKRVLTNFGIIDYFDFIYASNSELQPGKMEKPDKTIFDFTLNALQIDKTEAVMVGNTFESDIIGANRAGIHAIWLQNPEVCLQDERLPLVAPPFVIPVWDLADVPEALLLLKKIS 180
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3IB6)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3IB6)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3IB6)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3IB6)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3ib6)
 
  Sites
(no "Sites" information available for 3ib6)
 
  Cis Peptide Bonds
    Ala A:156 - Pro A:157   [ RasMol ]  
    Ala B:156 - Pro B:157   [ RasMol ]  
    Ala C:156 - Pro C:157   [ RasMol ]  
    Ala D:156 - Pro D:157   [ RasMol ]  
    Lys A:96 - Pro A:97   [ RasMol ]  
    Lys B:96 - Pro B:97   [ RasMol ]  
    Lys C:96 - Pro C:97   [ RasMol ]  
    Lys D:96 - Pro D:97   [ RasMol ]  
    Pro A:157 - Pro A:158   [ RasMol ]  
    Pro B:157 - Pro B:158   [ RasMol ]  
    Pro C:157 - Pro C:158   [ RasMol ]  
    Pro D:157 - Pro D:158   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3ib6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3IB6)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3IB6)