Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  TERNARY COMPLEX STRUCTURE OF LEUCOANTHOCYANIDIN REDUCTASE FROM VITIS VINIFERA
 
Authors :  C. Mauge, M. Gargouri, B. L. D'Estaintot, T. Granier, B. Gallois
Date :  03 Jul 09  (Deposition) - 23 Feb 10  (Release) - 20 Nov 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.28
Chains :  Asym./Biol. Unit :  A
Keywords :  Rossmann Fold, Short Chain Dehydrogenase Reductase, Flavonoid, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Mauge, T. Granier, B. L. D'Estaintot, M. Gargouri, C. Manigand, J. M. Schmitter, J. Chaudiere, B. Gallois
Crystal Structure And Catalytic Mechanism Of Leucoanthocyanidin Reductase From Vitis Vinifera.
J. Mol. Biol. V. 397 1079 2010
PubMed-ID: 20138891  |  Reference-DOI: 10.1016/J.JMB.2010.02.002

(-) Compounds

Molecule 1 - PUTATIVE LEUCOANTHOCYANIDIN REDUCTASE 1
    ChainsA
    EC Number1.17.1.3
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPETGB1A
    Expression System StrainBL21[DE3]
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneLAR1
    Organism CommonWINE GRAPE
    Organism ScientificVITIS VINIFERA
    Organism Taxid29760

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric/Biological Unit (2, 2)
No.NameCountTypeFull Name
1KXN1Ligand/Ion(2R,3S)-2-(3,4-DIHYDROXYPHENYL)-3,4-DIHYDRO-2H-CHROMENE-3,5,7-TRIOL
2NAP1Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:17 , THR A:19 , GLY A:20 , PHE A:21 , ILE A:22 , ARG A:42 , LEU A:68 , ILE A:69 , ASN A:70 , THR A:90 , VAL A:91 , GLY A:92 , SER A:95 , ASP A:98 , SER A:118 , GLU A:119 , PHE A:120 , LYS A:140 , ASN A:160 , ILE A:162 , HIS A:172 , KXN A:501 , HOH A:524 , HOH A:572 , HOH A:606 , HOH A:663BINDING SITE FOR RESIDUE NAP A 401
2AC2SOFTWAREGLY A:93 , GLU A:94 , GLY A:121 , HIS A:122 , MET A:136 , TYR A:137 , ILE A:171 , PHE A:272 , NAP A:401 , HOH A:552 , HOH A:565 , HOH A:606 , HOH A:642 , HOH A:646BINDING SITE FOR RESIDUE KXN A 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3I52)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Glu A:131 -Pro A:132
2Ile A:264 -Pro A:265

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3I52)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3I52)

(-) Exons   (0, 0)

(no "Exon" information available for 3I52)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:296
 aligned with Q4W2K4_VITVI | Q4W2K4 from UniProtKB/TrEMBL  Length:346

    Alignment length:307
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       
         Q4W2K4_VITVI    11 GRVLIAGATGFIGQFVATASLDAHRPTYILARPGPRSPSKAKIFKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVVSTVGGESILDQIALVKAMKAVGTIKRFLPSEFGHDVNRADPVEPGLNMYREKRRVRQLVEESGIPFTYICCNSIASWPYYNNIHPSEVLPPTDFFQIYGDGNVKAYFVAGTDIGKFTMKTVDDVRTLNKSVHFRPSCNCLNINELASVWEKKIGRTLPRVTVTEDDLLAAAGENIIPQSVVAAFTHDIFIKGCQVNFSIDGPEDVEVTTLYPEDSFRTVEECFGEYIVK 317
               SCOP domains d3i52a_ A: automated matches                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 3i52A01 A:11-158,A:198-220,A:286           -299 NAD(P)-binding Rossmann-like Domain                                                                 3i52A02 A:159-197,A:221-285,A:300-317  3i52A01                3i52A02 A:159-197,A:221-285,A:300-317                            3i52A01       3i52A02            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee...hhhhhhhhhhhhhh...eeeee.-----------hhhhhhh..eeee....hhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhhh...eee...............hhhhhhhhhhhhhhhhhhh....eeee..ee.........hhhhh......eeee......eeeehhhhhhhhhhhhhhhhhhh.eeee..hhh.eehhhhhhhhhhhhhh....eeeehhhhhhhhhhh...hhhhhhhhhhhhhh.............eeehhhhh......hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3i52 A  11 GRVLIAGATGFIGQFVATASLDAHRPTYILAR-----------FKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVVSTVGGESILDQIALVKAMKAVGTIKRFLPSEFGHDVNRADPVEPGLNMYREKRRVRQLVEESGIPFTYICCNSIASWPYYNNIHPSEVLPPTDFFQIYGDGNVKAYFVAGTDIGKFTMKTVDDVRTLNKSVHFRPSCNCLNINELASVWEKKIGRTLPRVTVTEDDLLAAAGENIIPQSVVAAFTHDIFIKGCQVNFSIDGPEDVEVTTLYPEDSFRTVEECFGEYIVK 317
                                    20        30        40 |       -   |    60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       
                                                          42          54                                                                                                                                                                                                                                                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3I52)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q4W2K4_VITVI | Q4W2K4)
molecular function
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    KXN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:131 - Pro A:132   [ RasMol ]  
    Ile A:264 - Pro A:265   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3i52
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q4W2K4_VITVI | Q4W2K4
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.17.1.3
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q4W2K4_VITVI | Q4W2K4
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q4W2K4_VITVI | Q4W2K43i5m 3i6i 3i6q

(-) Related Entries Specified in the PDB File

3i5m STRUCTURE OF APO FORM OF LEUCOANTHOCYANIDIN REDUCTASE
3i6i