Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF SIGNAL RECEIVER DOMAIN OF HD DOMAIN-CONTAINING PROTEIN FROM PSEUDOMONAS FLUORESCENS PF-5
 
Authors :  Y. Patskovsky, U. Ramagopal, R. Toro, J. Freeman, S. Miller, J. M. Sauder, S. K. Burley, S. C. Almo, New York Sgx Research Center For Structural Genomics (Nysgxrc)
Date :  15 Jun 09  (Deposition) - 23 Jun 09  (Release) - 23 Jun 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Response Regulator/Hd Domain Protein, Psi-2, Nysgxrc, Structural Genomics, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Signal Recognition, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Patskovsky, U. Ramagopal, R. Toro, J. Freeman, S. Miller, J. M. Sauder, S. K. Burley, S. C. Almo
Crystal Structure Of Signal Receiver Domain Of Hd Domain-Containing Protein 3 From Pseudomonas Fluorescens
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - RESPONSE REGULATOR/HD DOMAIN PROTEIN
    AtccBAA-477
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidBC-PSGX3(BC)
    Expression System StrainBL21(DE3)-CODON+RIL(STRATAGENE)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentRESIDUES 2-143
    GenePFL_4895
    Organism ScientificPSEUDOMONAS FLUORESCENS PF-5
    Organism Taxid220664
    StrainPF-5
    SynonymSIGNAL RECEIVER DOMAIN

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 3)

Asymmetric/Biological Unit (1, 3)
No.NameCountTypeFull Name
1SO43Ligand/IonSULFATE ION

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREALA A:63 , ALA A:64 , HIS A:65 , LEU A:90 , THR A:91 , LYS A:114 , HOH A:169 , HOH A:193BINDING SITE FOR RESIDUE SO4 A 152
2AC2SOFTWAREARG A:12 , HOH A:291 , ALA B:63 , ALA B:64 , HIS B:65 , THR B:91 , GLY B:92 , LYS B:114 , HOH B:172 , HOH B:252BINDING SITE FOR RESIDUE SO4 B 152
3AC3SOFTWAREHIS A:133 , HOH A:166 , HOH A:242 , HOH A:388 , HIS B:40 , ARG B:55 , HOH B:225BINDING SITE FOR RESIDUE SO4 B 153

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3HV2)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Lys A:114 -Pro A:115
2Lys B:114 -Pro B:115

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3HV2)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3HV2)

(-) Exons   (0, 0)

(no "Exon" information available for 3HV2)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:136
 aligned with Q4K707_PSEF5 | Q4K707 from UniProtKB/TrEMBL  Length:448

    Alignment length:136
                                    13        23        33        43        53        63        73        83        93       103       113       123       133      
         Q4K707_PSEF5     4 LNVATVTRRPEILLVDSQEVILQRLQQLLSPLPYTLHFARDATQALQLLASREVDLVISAAHLPQMDGPTLLARIHQQYPSTTRILLTGDPDLKLIAKAINEGEIYRYLSKPWDDQELLLALRQALEHQHSERERL 139
               SCOP domains d3hv2a_ A: automated matches                                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eeeee..hhhhhhhhhhhhh....eeeee.hhhhhhhhhhhh...eeeee......hhhhhhhhhhhhh...eeeee....hhhhhhhhhhh....eee....hhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3hv2 A   4 LNVATVTRRPEILLVDSQEVILQRLQQLLSPLPYTLHFARDATQALQLLASREVDLVISAAHLPQMDGPTLLARIHQQYPSTTRILLTGDPDLKLIAKAINEGEIYRYLSKPWDDQELLLALRQALEHQHSERERL 139
                                    13        23        33        43        53        63        73        83        93       103       113       123       133      

Chain B from PDB  Type:PROTEIN  Length:125
 aligned with Q4K707_PSEF5 | Q4K707 from UniProtKB/TrEMBL  Length:448

    Alignment length:125
                                    20        30        40        50        60        70        80        90       100       110       120       130     
         Q4K707_PSEF5    11 RRPEILLVDSQEVILQRLQQLLSPLPYTLHFARDATQALQLLASREVDLVISAAHLPQMDGPTLLARIHQQYPSTTRILLTGDPDLKLIAKAINEGEIYRYLSKPWDDQELLLALRQALEHQHSE 135
               SCOP domains d3hv2b_ B: automated matches                                                                                                  SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..hhhhhhhhhhhhh....eeeee.hhhhhhhhhh.....eeee.......hhhhhhhhhhhhh...eeeeee...hhhhhhhhhhh....eeee...hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript
                 3hv2 B  11 RRPEILLVDSQEVILQRLQQLLSPLPYTLHFARDATQALQLLASREVDLVISAAHLPQMDGPTLLARIHQQYPSTTRILLTGDPDLKLIAKAINEGEIYRYLSKPWDDQELLLALRQALEHQHSE 135
                                    20        30        40        50        60        70        80        90       100       110       120       130     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3HV2)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3HV2)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q4K707_PSEF5 | Q4K707)
molecular function
    GO:0000156    phosphorelay response regulator activity    Responds to a phosphorelay sensor to initiate a change in cell state or activity. The activity of the response regulator is regulated by transfer of a phosphate from a histidine residue in the sensor, to an aspartate residue in the response regulator. Many but not all response regulators act as transcriptional regulators to elicit a response.
biological process
    GO:0000160    phosphorelay signal transduction system    A conserved series of molecular signals found in prokaryotes and eukaryotes; involves autophosphorylation of a histidine kinase and the transfer of the phosphate group to an aspartate that then acts as a phospho-donor to response regulator proteins.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Lys A:114 - Pro A:115   [ RasMol ]  
    Lys B:114 - Pro B:115   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3hv2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q4K707_PSEF5 | Q4K707
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q4K707_PSEF5 | Q4K707
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3HV2)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3HV2)