3HQ6 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CYTOCHROME C PEROXIDASE FROM G. SULFURREDUCENS, WILD TYPE

Authors :   M. Hoffmann, J. Seidel, O. Einsle

Date :   05 Jun 09 (Deposition) - 22 Sep 09 (Release) - 03 Nov 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym./Biol. Unit : A,B

Keywords :   Cytochrome C, Oxidoreductase, Peroxidase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Hoffmann, J. Seidel, O. Einsle
Ccpa From Geobacter Sulfurreducens Is A Basic Di-Heme Cytochrome C Peroxidase.
J. Mol. Biol. V. 393 951 2009
PubMed-ID: 19735665 | Reference-DOI: 10.1016/J.JMB.2009.09.001
(for further references see the PDB file header)

Molecule 1 - CYTOCHROME C551 PEROXIDASE
	Chains	:	A, B
	EC Number	:	1.11.1.5
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Gene	:	CCPA, CCPA-2, GSU2813
	Organism Scientific	:	GEOBACTER SULFURREDUCENS
	Organism Taxid	:	35554

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 6)

No.	Name	Count	Type	Full Name
1	CA	2	Ligand/Ion	CALCIUM ION
2	HEM	4	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ILE A:71 , SER A:72 , CYS A:73 , CYS A:76 , HIS A:77 , SER A:90 , THR A:91 , GLY A:92 , HIS A:93 , TRP A:95 , GLN A:96 , ARG A:100 , PRO A:103 , ASN A:111 , TRP A:116 , SER A:134 , GLU A:182 , HOH A:416 , HOH A:418 , HOH A:419 , HOH A:470 , HOH A:471 , HOH A:621	BINDING SITE FOR RESIDUE HEM A 400
2	AC2	SOFTWARE	TRP A:116 , CYS A:219 , CYS A:222 , HIS A:223 , PHE A:236 , VAL A:238 , ARG A:268 , ALA A:269 , PRO A:270 , LEU A:272 , TYR A:281 , PHE A:282 , HIS A:283 , MET A:297 , ILE A:314 , HOH A:392 , HOH A:393 , HOH A:394 , HOH A:409	BINDING SITE FOR RESIDUE HEM A 401
3	AC3	SOFTWARE	ASN A:101 , THR A:278 , PRO A:280 , HOH A:393 , HOH A:394 , HOH A:405 , HOH A:407	BINDING SITE FOR RESIDUE CA A 402
4	AC4	SOFTWARE	ILE B:71 , SER B:72 , CYS B:73 , CYS B:76 , HIS B:77 , SER B:90 , THR B:91 , GLY B:92 , HIS B:93 , TRP B:95 , GLN B:96 , ARG B:100 , PRO B:103 , ASN B:111 , GLN B:114 , PHE B:115 , TRP B:116 , PRO B:130 , SER B:134 , GLU B:182 , HOH B:384 , HOH B:385 , HOH B:630 , HOH B:719	BINDING SITE FOR RESIDUE HEM B 400
5	AC5	SOFTWARE	TRP B:116 , CYS B:219 , CYS B:222 , HIS B:223 , PHE B:236 , VAL B:238 , ARG B:268 , ALA B:269 , PRO B:270 , LEU B:272 , TYR B:281 , PHE B:282 , HIS B:283 , MET B:297 , ILE B:304 , HOH B:428 , HOH B:429 , HOH B:430 , HOH B:431	BINDING SITE FOR RESIDUE HEM B 401
6	AC6	SOFTWARE	ASN B:101 , THR B:278 , PRO B:280 , HOH B:429 , HOH B:430 , HOH B:433 , HOH B:434	BINDING SITE FOR RESIDUE CA B 402

(no "SS Bond" information available for 3HQ6)

Asymmetric/Biological Unit

No.	Residues
1	Tyr A:279	-	Pro A:280
2	Tyr B:279	-	Pro B:280

(no "SAP(SNP)/Variant" information available for 3HQ6)

(no "PROSITE Motif" information available for 3HQ6)

(no "Exon" information available for 3HQ6)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:324
 aligned with Q749D0_GEOSL | Q749D0 from UniProtKB/TrEMBL  Length:345

    Alignment length:324
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341    
         Q749D0_GEOSL    22 ADELQQRAQGLFKPVPAKAPTLKGNPASPVKVELGKMLYFDPRLSASHLISCNTCHNVGLGGGDLQATSTGHGWQKGPRNAPTVLNSVFNTAQFWDGRAKDLAEQAKGPVQASVEMNNTPDQVVKTLNSIPDYVALFKKAFPGEKDPVTFDNMAKAIEVFEATLITPDSPFDQYLKGKKKALDGKQTAGLKLFLDKGCVACHGGLNLGGTGYFPFGVVEKPAENILPLGDKGRFAVTNTAKDEYVFRAPSLRNVAITYPYFHSGVVWSLKEAVAVMGSAQFGIKLSDDESEAIAAFLGSLTGKQPKVVYPIMPASTDATPRPRL 345
               SCOP domains d3hq6a1 A:22-188 automated matches                                                                                                                                     d3hq6a2 A:189-345 automated matches                                                                                                                           SCOP domains
               CATH domains 3hq6A01          3hq6A02 A:39-186,A:325-345 Cytochrome c                                                                                                             3hq6A01 A:22-38,A:187-324 Cytochrome c                                                                                                    3hq6A02 Cytochrome c  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhh...............hhhhhhhhhhhhhhhhhh.....hhhhhh.............................hhhhh.....eeehhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh....hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh..........ee.eeeee..........hhh.eeeee.hhh.eeee.....hhhhh..........hhhhhhhhhhhhhhh...hhhhhhhhhhhhhh......................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3hq6 A  22 ADELQQRAQGLFKPVPAKAPTLKGNPASPVKVELGKMLYFDPRLSASHLISCNTCHNVGLGGGDLQATSTGHGWQKGPRNAPTVLNSVFNTAQFWDGRAKDLAEQAKGPVQASVEMNNTPDQVVKTLNSIPDYVALFKKAFPGEKDPVTFDNMAKAIEVFEATLITPDSPFDQYLKGKKKALDGKQTAGLKLFLDKGCVACHGGLNLGGTGYFPFGVVEKPAENILPLGDKGRFAVTNTAKDEYVFRAPSLRNVAITYPYFHSGVVWSLKEAVAVMGSAQFGIKLSDDESEAIAAFLGSLTGKQPKVVYPIMPASTDATPRPRL 345
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341

Chain B from PDB  Type:PROTEIN  Length:313
 aligned with Q749D0_GEOSL | Q749D0 from UniProtKB/TrEMBL  Length:345

    Alignment length:324
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341    
         Q749D0_GEOSL    22 ADELQQRAQGLFKPVPAKAPTLKGNPASPVKVELGKMLYFDPRLSASHLISCNTCHNVGLGGGDLQATSTGHGWQKGPRNAPTVLNSVFNTAQFWDGRAKDLAEQAKGPVQASVEMNNTPDQVVKTLNSIPDYVALFKKAFPGEKDPVTFDNMAKAIEVFEATLITPDSPFDQYLKGKKKALDGKQTAGLKLFLDKGCVACHGGLNLGGTGYFPFGVVEKPAENILPLGDKGRFAVTNTAKDEYVFRAPSLRNVAITYPYFHSGVVWSLKEAVAVMGSAQFGIKLSDDESEAIAAFLGSLTGKQPKVVYPIMPASTDATPRPRL 345
               SCOP domains d3hq6b1 B:22-188 automated matches                                                                                                                                     d3hq6b2 B:189-345 automated matches                                                                                                                           SCOP domains
               CATH domains 3hq6B01          3hq6B02 B:39-186,B:325-345 Cytochrome c                                                                                                             3hq6B01 B:22-38,B:187-324 Cytochrome c                                                                                                    3hq6B02 Cytochrome c  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhh.....hhhhhh.............................hhhhh.....eeehhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh....hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh..........ee.eeeee.-----------..eeeee.hhh.eeee.....hhhhh..........hhhhhhhhh.hhhhh...hhhhhhhhhhhhhhhh....................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3hq6 B  22 ADELQQRAQGLFKPVPAKAPTLKGNPASPVKVELGKMLYFDPRLSASHLISCNTCHNVGLGGGDLQATSTGHGWQKGPRNAPTVLNSVFNTAQFWDGRAKDLAEQAKGPVQASVEMNNTPDQVVKTLNSIPDYVALFKKAFPGEKDPVTFDNMAKAIEVFEATLITPDSPFDQYLKGKKKALDGKQTAGLKLFLDKGCVACHGGLNLGGTGYFPFGVVEK-----------GRFAVTNTAKDEYVFRAPSLRNVAITYPYFHSGVVWSLKEAVAVMGSAQFGIKLSDDESEAIAAFLGSLTGKQPKVVYPIMPASTDATPRPRL 345
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241         - |     261       271       281       291       301       311       321       331       341    
                                                                                                                                                                                                                                                     241         253

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Cytochrome c (308)

Superfamily: Cytochrome c (308)

Family: automated matches (31)

Protein domain: automated matches (31)

Geobacter sulfurreducens [TaxId: 35554] (6)

1a	d3hq6a1	A:22-188
1b	d3hq6a2	A:189-345
1c	d3hq6b1	B:22-188
1d	d3hq6b2	B:189-345

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Cytochrome Bc1 Complex; Chain D, domain 2 (279)

Homologous Superfamily: Cytochrome c (279)

Geobacter sulfurreducens. Organism_taxid: 35554. (4)

1a	3hq6B01	B:22-38,B:187-324
1b	3hq6A02	A:39-186,A:325-345
1c	3hq6B02	B:39-186,B:325-345
1d	3hq6A01	A:22-38,A:187-324

(no "Pfam Domain" information available for 3HQ6)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (Q749D0_GEOSL | Q749D0)

molecular function
	GO:0004130	cytochrome-c peroxidase activity	Catalysis of the reaction: 2 ferrocytochrome c + hydrogen peroxide = 2 ferricytochrome c + 2 H2O.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0004601	peroxidase activity	Catalysis of the reaction: donor + hydrogen peroxide = oxidized donor + 2 H2O.
biological process
	GO:0098869	cellular oxidant detoxification	Any process carried out at the cellular level that reduces or removes the toxicity superoxide radicals or hydrogen peroxide.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Tyr A:279 - Pro A:280	[ RasMol ]
		Tyr B:279 - Pro B:280	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3hq6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q749D0_GEOSL \| Q749D0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	1.11.1.5
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q749D0_GEOSL \| Q749D0
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/TrEMBL
	Q749D0_GEOSL \| Q749D0	:	3hq7 3hq8 3hq9

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File