Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PSYCHROTROPHIC ESTERASE ESTA FROM PSEUDOALTEROMONAS SP. 643A INHIBITED BY MONOETHYLPHOSPHONATE
 
Authors :  A. Brzuszkiewicz, E. Nowak, Z. Dauter, M. Dauter, H. Cieslinski, J. Kur
Date :  03 Jun 09  (Deposition) - 30 Jun 09  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.35
Chains :  Asym./Biol. Unit :  A
Keywords :  Esterase, Psychrotrophic, Monoethylphosphonate, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Brzuszkiewicz, E. Nowak, Z. Dauter, M. Dauter, H. Cieslinski, A. Dlugolecka, J. Kur
Structure Of Esta Esterase From Psychrotrophic Pseudoalteromonas Sp. 643A Covalently Inhibited By Monoethylphosphonate.
Acta Crystallogr. , Sect. F V. 65 862 2009
PubMed-ID: 19724118  |  Reference-DOI: 10.1107/S1744309109030826

(-) Compounds

Molecule 1 - GDSL-ESTERASE
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PRCS69
    Expression System Strain: BL21
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 24-207
    Gene: ESTA
    Organism Scientific: PSEUDOALTEROMONAS SP.
    Organism Taxid: 336179
    Strain: 643A

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1MIR1Mod. Amino AcidMONOETHYLPHOSPHORYLSERINE

(-) Sites  (0, 0)

(no "Site" information available for 3HP4)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3HP4)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3HP4)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3HP4)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3HP4)

(-) Exons   (0, 0)

(no "Exon" information available for 3HP4)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:183
 aligned with Q1G1I7_9GAMM | Q1G1I7 from UniProtKB/TrEMBL  Length:207

    Alignment length:183
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203   
         Q1G1I7_9GAMM    24 DNTILILGDSLSAAYGLQQEEGWVKLLQDKYDAEQSDIVLINASISGETSGGALRRLDALLEQYEPTHVLIELGANDGLRGFPVKKMQTNLTALVKKSQAANAMTALMEIYIPPNYGPRYSKMFTSSFTQISEDTNAHLMNFFMLDIAGKSDLMQNDSLHPNKKAQPLIRDEMYDSIKKWLNN 206
               SCOP domains d3hp4a_ A: automated matches                                                                                                                                                            SCOP domains
               CATH domains 3hp4A00 A:2-184  [code=3.40.50.1110, no name defined]                                                                                                                                   CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.........hhhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhhhhh..eeeee.hhhhhhh..hhhhhhhhhhhhhhhhhhh..eeeee........hhhhhhhhhhhhhhhhhhhh.eee.........hhhhh.........hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3hp4 A   2 DNTILILGDsLSAAYGLQQEEGWVKLLQDKYDAEQSDIVLINASISGETSGGALRRLDALLEQYEPTHVLIELGANDGLRGFPVKKMQTNLTALVKKSQAANAMTALMEIYIPPNYGPRYSKMFTSSFTQISEDTNAHLMNFFMLDIAGKSDLMQNDSLHPNKKAQPLIRDEMYDSIKKWLNN 184
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181   
                                    11-MIR
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3HP4)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3HP4)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MIR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3hp4)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3hp4)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3hp4
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q1G1I7_9GAMM | Q1G1I7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q1G1I7_9GAMM | Q1G1I7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3HP4)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3HP4)