Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF GLUCOSAMINE-6-PHOSPHATE DEAMINASE FROM BORRELIA BURGDORFERI
 
Authors :  Seattle Structural Genomics Center For Infectious Disease (S
Date :  29 May 09  (Deposition) - 09 Jun 09  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F
Keywords :  Niaid, Ssgcid, Decode, Uw, Sbri, Infectious Disease, Lyme Disease, Non-Hodgkin Lymphomas, Neuroborreliosis, Allosteric Enzyme, Carbohydrate Metabolism, Hydrolase, Isomerase, Structural Genomics, Seattle Structural Genomics Center For Infectious Disease (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. E. Edwards, J. A. Abendroth, B. L. Staker, Seattle Structural Genomics Center For Infectious Disease
Crystal Structure Of Glucosamine-6-Phosphate Deaminase From Borrelia Burgdorferi
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - GLUCOSAMINE-6-PHOSPHATE DEAMINASE
    Chains: A, B, C, D, E, F
    EC Number: 3.5.99.6
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: AVA0421
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: NAGB, BB_0152
    Organism Scientific: BORRELIA BURGDORFERI
    Organism Taxid: 224326
    Strain: B31
    Synonym: GLUCOSAMINE-6-PHOSPHATE ISOMERASE, GLCN6P DEAMINASE, GNPDA

 Structural Features

(-) Chains, Units

  123456
Asymmetric/Biological Unit : ABCDEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 3)

Asymmetric/Biological Unit (1, 3)
No.NameCountTypeFull Name
1POP3Ligand/IonPYROPHOSPHATE 2-

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:210 , LYS A:213 , HIS A:214 , ARG B:210 , LYS B:213 , HIS B:214 , HOH B:742 , HOH B:743BINDING SITE FOR RESIDUE POP B 303
2AC2SOFTWAREARG C:210 , LYS C:213 , HIS C:214 , HOH C:820 , ARG F:210 , LYS F:213 , HIS F:214BINDING SITE FOR RESIDUE POP C 302
3AC3SOFTWAREARG D:210 , LYS D:213 , HIS D:214 , ARG E:210 , LYS E:213 , HIS E:214 , LYS E:218BINDING SITE FOR RESIDUE POP D 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3HN6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3HN6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3HN6)

(-) PROSITE Motifs  (1, 6)

Asymmetric/Biological Unit (1, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GLC_GALNAC_ISOMERASEPS01161 Glucosamine/galactosamine-6-phosphate isomerases signature.NAGB_BORBU125-143
 
 
 
 
 		  6A:125-143
B:125-143
C:125-143
D:125-143
E:125-143
F:125-143

(-) Exons   (0, 0)

(no "Exon" information available for 3HN6)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:271
 aligned with NAGB_BORBU | O30564 from UniProtKB/Swiss-Prot  Length:268

    Alignment length:271
                               1                                                                                                                                                                                                                                                                           
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267 
           NAGB_BORBU     - ---MRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEENHPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIKTLTQDTIIANSRFFEGDVNKVPKNALTVGIGTIMDSQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVSDKNATYELKVGTVEYFNDIERKNFNNDLK 268
               SCOP domains d3hn6a_ A: automated matches                                                                                                                                                                                                                                                    SCOP domains
               CATH domains 3hn6A00 A:-2-268  [code=3.40.50.1360, no name defined]                                                                                                                                                                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeee.hhhhhhhhhhhhhhhhhhhhh......eeeee.....hhhhhhhhhhhhhh.......eeeee.eee.........hhhhhhhhhhhhhh..hhh.ee.......hhhhhhhhhhhhhhhh....eeeee....................eeee.hhhhhhhhhhhh.........eeee.hhhhhhh...eeeee.hhhhhhhhhhhhh......hhhhhhhhh..eeeeee.hhhh..hhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------GLC_GALNAC_ISOMERAS----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3hn6 A  -2 PGSMRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEENHPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIKTLTQDTIIANSRFFEGDVNKVPKNALTVGIGTIMDSQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVSDKNATYELKVGTVEYFNDIERKNFNNDLK 268
                                     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267 


Chain B from PDB  Type:PROTEIN  Length:270
 aligned with NAGB_BORBU | O30564 from UniProtKB/Swiss-Prot  Length:268

    Alignment length:270
                               1                                                                                                                                                                                                                                                                          
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267
           NAGB_BORBU     - ---MRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEENHPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIKTLTQDTIIANSRFFEGDVNKVPKNALTVGIGTIMDSQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVSDKNATYELKVGTVEYFNDIERKNFNNDL 267
               SCOP domains d3hn6b_ B: automated matches                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 3hn6B00 B:-2-267  [code=3.40.50.1360, no name defined]                                                                                                                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeee.hhhhhhhhhhhhhhhhhhhhh......eeeee.....hhhhhhhhhhhhhh.......eeeee.eee.........hhhhhhhhhhhhhh..hhh.ee.......hhhhhhhhhhhhhhhh....eeeee....................eeee.hhhhhhhhhhhhh.hhhhh..eeee.hhhhhhhh..eeeee.hhhhhhhhhhhhh......hhhhhhhhh..eeeeee.hhhh..hhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------GLC_GALNAC_ISOMERAS---------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3hn6 B  -2 PGSMRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEENHPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIKTLTQDTIIANSRFFEGDVNKVPKNALTVGIGTIMDSQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVSDKNATYELKVGTVEYFNDIERKNFNNDL 267
                                     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267


Chain C from PDB  Type:PROTEIN  Length:271
 aligned with NAGB_BORBU | O30564 from UniProtKB/Swiss-Prot  Length:268

    Alignment length:271
                               1                                                                                                                                                                                                                                                                           
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267 
           NAGB_BORBU     - ---MRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEENHPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIKTLTQDTIIANSRFFEGDVNKVPKNALTVGIGTIMDSQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVSDKNATYELKVGTVEYFNDIERKNFNNDLK 268
               SCOP domains d3hn6c_ C: automated matches                                                                                                                                                                                                                                                    SCOP domains
               CATH domains 3hn6C00 C:-2-268  [code=3.40.50.1360, no name defined]                                                                                                                                                                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeee.hhhhhhhhhhhhhhhhhhhhh......eeeee.....hhhhhhhhhhhhhh.......eeeee.eee.........hhhhhhhhhhhhhh..hhh.ee.......hhhhhhhhhhhhhhhh....eeeee....................eeee.hhhhhhhhhhhh.........eeee.hhhhhhh...eeeee.hhhhhhhhhhhhh......hhhhhhhhh..eeeeee.hhhh..hhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------GLC_GALNAC_ISOMERAS----------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3hn6 C  -2 PGSMRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEENHPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIKTLTQDTIIANSRFFEGDVNKVPKNALTVGIGTIMDSQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVSDKNATYELKVGTVEYFNDIERKNFNNDLK 268
                                     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267 


Chain D from PDB  Type:PROTEIN  Length:270
 aligned with NAGB_BORBU | O30564 from UniProtKB/Swiss-Prot  Length:268

    Alignment length:270
                               1                                                                                                                                                                                                                                                                          
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267
           NAGB_BORBU     - ---MRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEENHPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIKTLTQDTIIANSRFFEGDVNKVPKNALTVGIGTIMDSQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVSDKNATYELKVGTVEYFNDIERKNFNNDL 267
               SCOP domains d3hn6d_ D: automated matches                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 3hn6D00 D:-2-267  [code=3.40.50.1360, no name defined]                                                                                                                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeee.hhhhhhhhhhhhhhhhhhhhh......eeeee.....hhhhhhhhhhhhhh.......eeeee.eee.........hhhhhhhhhhhhhh..hhh.ee.......hhhhhhhhhhhhhhhh....eeeee....................eeee.hhhhhhhhhh...........eeee.hhhhhhh...eeeee.hhhhhhhhhhhhh......hhhhhhhhh..eeeeee.hhhh..hhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------GLC_GALNAC_ISOMERAS---------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3hn6 D  -2 PGSMRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEENHPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIKTLTQDTIIANSRFFEGDVNKVPKNALTVGIGTIMDSQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVSDKNATYELKVGTVEYFNDIERKNFNNDL 267
                                     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267


Chain E from PDB  Type:PROTEIN  Length:266
 aligned with NAGB_BORBU | O30564 from UniProtKB/Swiss-Prot  Length:268

    Alignment length:270
                               1                                                                                                                                                                                                                                                                          
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267
           NAGB_BORBU     - ---MRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEENHPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIKTLTQDTIIANSRFFEGDVNKVPKNALTVGIGTIMDSQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVSDKNATYELKVGTVEYFNDIERKNFNNDL 267
               SCOP domains d3hn6e_ E: automated matches                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 3hn6E00 E:-2-267  [code=3.40.50.1360, no name defined]                                                                                                                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeee.hhhhhhhhhhhhhhhhhhhhh......eeeee.....hhhhhhhhhhhhhh.......eeeee.eee.........hhhhhhhhhhhhhh..hhh.ee.......hhhhhhhhhhhhhhhh....eeeee....................eeee.hhhhhhhh....----.....eeee.hhhhhhh...eeeee.hhhhhhhhhhhhh......hhhhhhhhh..eeeeee.hhhh..hhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------GLC_GALNAC_ISOMERAS---------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3hn6 E  -2 PGSMRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEENHPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIKTLTQDTIIANSRFF----NKVPKNALTVGIGTIMDSQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVSDKNATYELKVGTVEYFNDIERKNFNNDL 267
                                     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167      |  - |     187       197       207       217       227       237       247       257       267
                                                                                                                                                                                                          174  179                                                                                        


Chain F from PDB  Type:PROTEIN  Length:262
 aligned with NAGB_BORBU | O30564 from UniProtKB/Swiss-Prot  Length:268

    Alignment length:270
                               1                                                                                                                                                                                                                                                                          
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267
           NAGB_BORBU     - ---MRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEENHPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIKTLTQDTIIANSRFFEGDVNKVPKNALTVGIGTIMDSQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVSDKNATYELKVGTVEYFNDIERKNFNNDL 267
               SCOP domains d3hn6f_ F: automated matches                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 3hn6F00 F:-2-267  [code=3.40.50.1360, no name defined]                                                                                                                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeee.hhhhhhhhhhhhhhhhhhhhh......eeeee.....hhhhhhhhhhhhhh.......eeeee.eee.........hhhhhhhhhhhhhh..hhh.ee.......hhhhhhhhhhhhhhhh....eeeee....................eeee.hhhhhh--------.......eeee.hhhhhhh...eeeee.hhhhhhhhhhhhh......hhhhhhhhh..eeeeee.hhhh..hhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------GLC_GALNAC_ISOMERAS---------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3hn6 F  -2 PGSMRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEENHPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIKTLTQDTII--------DVNKVPKNALTVGIGTIMDSQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVSDKNATYELKVGTVEYFNDIERKNFNNDL 267
                                     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167|      177       187       197       207       217       227       237       247       257       267
                                                                                                                                                                                                    168      177
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 6)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 6)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3HN6)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D,E,F   (NAGB_BORBU | O30564)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0004342    glucosamine-6-phosphate deaminase activity    Catalysis of the reaction: D-glucosamine 6-phosphate + H(2)O = beta-D-fructose 6-phosphate + NH(4)(+).
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
biological process
    GO:0006044    N-acetylglucosamine metabolic process    The chemical reactions and pathways involving N-acetylglucosamine. The D isomer is a common structural unit of glycoproteins in plants, bacteria and animals; it is often the terminal sugar of an oligosaccharide group of a glycoprotein.
    GO:0019262    N-acetylneuraminate catabolic process    The chemical reactions and pathways resulting in the breakdown of N-acetylneuraminate, the anion of 5-(acetylamino)-3,5-dideoxy-D-glycero-D-galacto-non-3-ulosonic acid.
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    POP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3hn6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3hn6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NAGB_BORBU | O30564
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.5.99.6
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  NAGB_BORBU | O30564
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3HN6)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3HN6)